protein

Recombinant Human Taste receptor type 2 member 38 (TAS2R38)

MBS717641

1 mg (E Coli Derived

1375 USD

Recombinant Protein

Recombinant Human Taste receptor type 2 member 38 (TAS2R38)

Taste receptor type 2 member 38 (TAS2R38)

Recombinant Taste receptor type 2 member 38 (TAS2R38); Taste receptor type 2 member 38; T2R38; PTC bitter taste receptor Taste receptor type 2 member 61; T2R61

taste receptor type 2 member 38; Taste receptor type 2 member 38; taste receptor type 2 member 38; PTC bitter taste receptor; taste receptor type 2 member 61; taste receptor, type 2, member 38; PTC bitter taste receptor; Taste receptor type 2 member 61

TAS2R38; PTC

TAS2R38; TAS2R38; PTC; T2R38; T2R61; PTC; T2R38; T2R61

T2R38_HUMAN

E Coli or Yeast

1-333

333

MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLV
NFWDVVKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQL
THFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLY
CSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTV
LCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSF
LFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNS
RDPSLEAHIKALKSLVSFFCFFVISSCAAFISVPLLILW
RDKIGVMVCVGIMAACPSGHAAILISGNAKLRRAVMTIL
LWAQSSLKVRADHKADSRTLC

>90%

This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Tag Information: His tagged. Species: Homo sapiens (Human)

Storage Buffer: PBS pH 7.4, 50% glycerol

261490645

NP_789787.4

NM_176817.4

P59533

37,892 Da

Taste Transduction Pathway 83088!!Taste Transduction Pathway 499

This gene encodes a seven-transmembrane G protein-coupled receptor that controls the ability to taste glucosinolates, a family of bitter-tasting compounds found in plants of the Brassica sp. Synthetic compounds phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) have been identified as ligands for this receptor and have been used to test the genetic diversity of this gene. Although several allelic forms of this gene have been identified worldwide, there are two predominant common forms (taster and non-taster) found outside of Africa. These alleles differ at three nucleotide positions resulting in amino acid changes in the protein (A49P, A262V, and V296I) with the amino acid combination PAV identifying the taster variant (and AVI identifying the non-taster variant). [provided by RefSeq, Oct 2009]

Function: Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 . By similarity. Subcellular location: Membrane; Multi-pass membrane protein. Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Polymorphism: Variations in TAS2R38 are associated with the ability to taste phenylthiocarbamide (PTC tasting) [. MIM:171200]; also called thiourea tasting. The ability to taste the substance PTC and a number of related substances is genetically controlled. Genetic studies have demonstrated complex inheritance for this trait. For some people (and some chimpanzees also), the chemical PTC tastes very bitter. For others, it is tasteless. Actually, substantial variation in taste sensitivity exists in human. Five haplotypes arising from three coding SNPs in the TAS2R38 gene are associated with distinct phenotypes of PTC taste sensitivity. Miscellaneous: Most taste cells may be activated by a limited number of bitter compounds; individual taste cells can discriminate among bitter stimuli. Sequence similarities: Belongs to the G-protein coupled receptor T2R family.

1 mg (E Coli Derived)

1375 USD