catalog number :
MBS717635
products type :
Recombinant Protein
products full name :
Recombinant Human Large neutral amino acids transporter small subunit 1 (SLC7A5)
products short name :
Large neutral amino acids transporter small subunit 1 (SLC7A5)
products name syn :
Recombinant Large neutral amino acids transporter small subunit 1 (SLC7A5); Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC CD98 light chain Integral membrane protein E16 L-type amino acid transporter 1; hLAT1 Solute
other names :
large neutral amino acids transporter small subunit 1; Large neutral amino acids transporter small subunit 1; large neutral amino acids transporter small subunit 1; 4F2 LC; 4F2 light chain; CD98 light chain; integral membrane protein E16; L-type amino acid transporter 1; solute carrier family 7 member 5; large neutral amino acids transporter 1; y+ system cationic amino acid transporter; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; solute carrier family 7 (amino acid transporter light chain, L system), member 5; 4F2 light chain; 4F2 LC; 4F2LC; CD98 light chain; Integral membrane protein E16; L-type amino acid transporter 1; hLAT1; Solute carrier family 7 member 5; y+ system cationic amino acid transporter
products gene name syn :
SLC7A5; CD98LC, LAT1, MPE16
other gene names :
SLC7A5; SLC7A5; E16; CD98; LAT1; 4F2LC; MPE16; hLAT1; D16S469E; CD98LC; LAT1; MPE16; 4F2 LC; 4F2LC; hLAT1
uniprot entry name :
LAT1_HUMAN
sequence positions :
1-507
sequence :
MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAG
EGEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKE
AGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDY
AYMLEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYL
LKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATR
VQDAFAAAKLLALALIILLGFVQIGKGDVSNLDPNFSFE
GTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRN
LPLAIIISLPIVTLVYVLTNLAYFTTLSTEQMLSSEAVA
VDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFF
VGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFS
KDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPI
KVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSG
LPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQET
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged. Species: Homo sapiens (Human)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi acc num :
NP_003477.4
ncbi gb acc num :
NM_003486.5
ncbi mol weight :
55,010 Da
ncbi pathways :
Amino Acid Transport Across The Plasma Membrane Pathway 106170!!Basigin Interactions Pathway 106065!!Cell Surface Interactions At The Vascular Wall Pathway 106062!!Hemostasis Pathway 106028!!SLC-mediated Transmembrane Transport Pathway 119558!!Transmembrane Transport Of Small Molecules Pathway 106572!!Transport Of Inorganic Cations/anions And Amino Acids/oligopeptides Pathway 119559
uniprot summary :
Function: Sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Involved in cellular amino acid uptake. Acts as an amino acid exchanger. Involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Plays a role in neuronal cell proliferation (neurogenesis) in brain. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. May play an important role in high-grade gliomas. Mediates blood-to-retina L-leucine transport across the inner blood-retinal barrier which in turn may play a key role in maintaining large neutral amino acids as well as neurotransmitters in the neural retina. Acts as the major transporter of tyrosine in fibroblasts. Ref.1 Ref.2 Ref.4 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.15 Ref.19 Ref.21 Ref.23. Subunit structure: Disulfide-linked heterodimer with the amino acid transport protein SLC3A2/4F2hc. Ref.1 Ref.2 Ref.4 Ref.10 Ref.11 Ref.12 Ref.15 Ref.19. Subcellular location: Cytoplasm cytosol. Apical cell membrane; Multi-pass membrane protein. Note: Located to the plasma membrane by SLC3A2/4F2hc. Localized to the apical membrane of placental syncytiophoblastic cells. Expressed in both luminal and abluminal membranes of brain capillary endothelial cells . By similarity. Ref.10 Ref.11 Ref.13 Ref.15 Ref.18 Ref.21. Tissue specificity: Expressed abundantly in adult lung, liver, brain, skeletal muscle, placenta, bone marrow, testis, resting lymphocytes and monocytes, and in fetal liver. Weaker expression in thymus, cornea, retina, peripheral leukocytes, spleen, kidney, colon and lymph node. During gestation, expression in the placenta was significantly stronger at full-term than at the mid-trimester stage. Also expressed in all human tumor cell lines tested and in the astrocytic process of primary astrocytic gliomas. Expressed in retinal endothelial cells and in the intestinal epithelial cell line Caco-2. Ref.2 Ref.3 Ref.4 Ref.7 Ref.11 Ref.13 Ref.16 Ref.18 Ref.21. Induction: Expression induced in quiescent peripheral blood lymphocytes after treatment with phorbol myristate acetate (PMA) and phytohemagglutinin (PHA). Expression and the uptake of leucine is stimulated in mononuclear, cytotrophoblast-like choriocarcinoma cells by combined treatment with PMA and calcium ionophore. Ref.7 Ref.13. Miscellaneous: The uptake of leucine, tyrosine and tryptophan is inhibited by the different iodothyronines, in particular T3. Leucine transport is also inhibited by small zwitterionic amino acids (i.e. glycine, alanine, serine, threonine and cysteine) and by glutamine and asparginine. The uptake of T3 is almost completely blocked by coincubation with leucine, tryptophan, tyrosine, and phenylalanine, or 2-amino-bicyclo-(2,2,1)-heptane-2-carboxylate (BCH). Methionine uptake was inhibited by the L-system substrates L-leucine, BCH, L-cysteine and by the MeHg-L-cysteine complex and structurally related S-ethyl-L-cysteine. MeHg-L-cysteine uptake is inhibited by L-methionine, L-leucine, BCH and S-ethyl-L-cysteine. L-leucine uptake was inhibited by L-CNSO. Tyrosine uptake in fibroblasts was inhibited by D-methionine, and methyl-aminoisobutyric acid (MeAIB). Sequence similarities: Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family. [View classification]. Biophysicochemical propertiesKinetic parameters:KM=7.9 uM for T4 (in the presence of choline chloride) Ref.9 Ref.12 Ref.14 Ref.15 Ref.23KM=0.8 uM for T3 (in the presence of choline chloride)KM=12.5 uM for reverse triiodothyronine (rT3) (in the presence of choline chloride)KM=7.9 uM for 3,3'-diiodothyronine (in the presence of choline chloride)KM=46 uM for leucine (in the presence of choline chloride)KM=19 uM for tryptophan (in the presence of choline chloride)KM=32 uM for L-leucineKM=10 mM for L-alanineKM=2.2 mM for L-glutamineKM=35 uM for L-histidineKM=740 uM for L-phenylalanineKM=98 uM for MeHg-L-cysteineKM=99 uM for methionineKM=55.2 uM for phenylalanine (in T24 human bladder carcinoma cells)KM=60.4 uM for tyrosine (in T24 human bladder carcinoma cells)KM=16.4 uM for tyrosine (in human fibroblasts)KM=138 uM for Dopa (in T24 human bladder carcinoma cells)KM=96.5 uM for 3-O-methyldopa (in T24 human bladder carcinoma cells)KM=153 uM for alpha-methyltyrosine (in T24 human bladder carcinoma cells)KM=216 uM for alpha-methyldopa (in T24 human bladder carcinoma cells)KM=191 uM for gabapentin (in T24 human bladder carcinoma cells)KM=7.3 uM for triiodothyronine (in T24 human bladder carcinoma cells)KM=162 uM for thyroxine (in T24 human bladder carcinoma cells)KM=75.3 uM for melphanan (in T24 human bladder carcinoma cells)KM=156 uM for BCH (in T24 human bladder carcinoma cells)
size :
1 mg (E Coli Derived)