Recombinant Human Prostaglandin-H2 D-isomerase | MyBioSource MBS717549 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Prostaglandin-H2 D-isomerase

catalog :

MBS717549

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717549

products type :

Recombinant Protein

products full name :

Recombinant Human Prostaglandin-H2 D-isomerase

products short name :

Prostaglandin-H2 D-isomerase

products name syn :

Beta-trace protein; Cerebrin-28; Glutathione-independent PGD synthase; Lipocalin-type prostaglandin-D synthase; Prostaglandin-D2 synthase; PGD2 synthase; PGDS; PGDS2

other names :

prostaglandin-H2 D-isomerase; Prostaglandin-H2 D-isomerase; prostaglandin-H2 D-isomerase; prostaglandin D2 synthase; Beta-trace protein; Cerebrin-28; Glutathione-independent PGD synthase; Lipocalin-type prostaglandin-D synthase; Prostaglandin-D2 synthase; PGD2 synthase; PGDS; PGDS2

products gene name :

PTGDS

other gene names :

PTGDS; PTGDS; PDS; PGD2; PGDS; LPGDS; PGDS2; L-PGDS; PDS; PGD2 synthase; PGDS; PGDS2

uniprot entry name :

PTGDS_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

23-190, Mature full length protein

sequence length :

190

sequence :

APEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAA
LSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAG
SLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGP
GEDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIV
FLPQTDKCMTEQ

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Metabolism

products description :

Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NR sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system.

products references :

Human brain prostaglandin D synthase has been evolutionarily differentiated from lipophilic-ligand carrier proteins.Nagata A., Suzuki Y., Igarashi M., Eguchi N., Toh H., Urade Y., Hayaishi O.Proc. Natl. Acad. Sci. U.S.A. 88:4020-4024(1991)

ncbi gi num :

32171249

ncbi acc num :

NP_000945.3

ncbi gb acc num :

NM_000954.5

uniprot acc num :

P41222

ncbi mol weight :

34.69kD

ncbi pathways :

Arachidonic Acid Metabolism Pathway (82991); Arachidonic Acid Metabolism Pathway (1270087); Arachidonic Acid Metabolism Pathway (366); C20 Prostanoid Biosynthesis Pathway (545299); C20 Prostanoid Biosynthesis Pathway (908107); Eicosanoid Synthesis Pathway (198888); Metabolic Pathways (132956); Metabolism Pathway (1269956); Metabolism Of Lipids And Lipoproteins Pathway (1270001); Prostaglandin Synthesis And Regulation Pathway (198912)

ncbi summary :

The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. [provided by RefSeq, Jul 2008]

uniprot summary :

PTGDS: Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. Belongs to the calycin superfamily. Lipocalin family. Protein type: Isomerase; EC 5.3.99.2; Endoplasmic reticulum; Secreted, signal peptide; Lipid Metabolism - arachidonic acid; Secreted. Chromosomal Location of Human Ortholog: 9q34.2-q34.3. Cellular Component: endoplasmic reticulum membrane; extracellular region; extracellular space; Golgi apparatus; nuclear membrane; perinuclear region of cytoplasm; rough endoplasmic reticulum. Molecular Function: fatty acid binding; prostaglandin-D synthase activity; protein binding; retinoid binding; transporter activity. Biological Process: arachidonic acid metabolic process; cyclooxygenase pathway; prostaglandin biosynthetic process; regulation of circadian sleep/wake cycle, sleep; response to glucocorticoid stimulus; transport

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

910

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1135

more info or order :

MyBioSource product webpage