Recombinant Human Talin-1 | MyBioSource MBS717417 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Talin-1

catalog :

MBS717417

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717417

products type :

Recombinant Protein

products full name :

Recombinant Human Talin-1

products short name :

Talin-1

other names :

talin-1; Talin-1; talin-1; talin 1

products gene name :

TLN1

products gene name syn :

KIAA1027; TLN

other gene names :

TLN1; TLN1; TLN; ILWEQ; KIAA1027; TLN

uniprot entry name :

TLN1_HUMAN

host :

E Coli

sequence positions :

92-399

sequence length :

2541

sequence :

MLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLV
RELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDD
ELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRD
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQF
GPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNC
GQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKL
VPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPK
SFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDII

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Signal Transduction

products description :

Probably involved in connections of major cytoskeletal structures to the plasma membrane. High molecular weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts.

products references :

Complete cDNA sequence of human talin.Mao L., Fan Y.H.Characterization of the human talin (TLN) gene genomic structure, chromosomal localization, and expression pattern.Ben-Yosef T., Francomano C.A.Genomics 62:316-319(1999) Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 6:197-205(1999) Construction of expression-ready cDNA clones for KIAA genes manual curation of 330 KIAA cDNA clones.Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.DNA Res. 9:99-106(2002) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

ncbi gi num :

223029410

ncbi acc num :

NP_006280.3

ncbi gb acc num :

NM_006289.3

uniprot acc num :

Q9Y490

ncbi mol weight :

63.2kD

ncbi pathways :

ARMS-mediated Activation Pathway (1269471); Axon Guidance Pathway (1270303); Cytokine Signaling In Immune System Pathway (1269310); DAP12 Interactions Pathway (1269283); DAP12 Signaling Pathway (1269284); Developmental Biology Pathway (1270302); Downstream Signal Transduction Pathway (1269479); Downstream Signaling Of Activated FGFR1 Pathway (1269392); Downstream Signaling Of Activated FGFR2 Pathway (1269403); Downstream Signaling Of Activated FGFR3 Pathway (1269413)

ncbi summary :

This gene encodes a cytoskeletal protein that is concentrated in areas of cell-substratum and cell-cell contacts. The encoded protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin. [provided by RefSeq, Feb 2009]

uniprot summary :

Talin-1: a cytoskeletal protein which is concentrated in areas of cell-substratum and cell-cell contacts. This protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin. Protein type: Motility/polarity/chemotaxis; Cytoskeletal. Chromosomal Location of Human Ortholog: 9p13. Cellular Component: cell surface; cytoplasm; cytosol; extracellular region; focal adhesion; intercellular junction; microtubule organizing center; plasma membrane; ruffle. Molecular Function: actin filament binding; integrin binding; LIM domain binding; protein binding; structural constituent of cytoskeleton; vinculin binding. Biological Process: axon guidance; blood coagulation; cell motility; cell-substrate junction assembly; cellular protein metabolic process; cortical actin cytoskeleton organization and biogenesis; cytoskeletal anchoring; intercellular junction assembly; muscle contraction; platelet activation; platelet degranulation; unfolded protein response; viral reproduction

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage