Recombinant Human Transferrin receptor protein 1 | MyBioSource MBS717415 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Transferrin receptor protein 1

catalog :

MBS717415

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717415

products type :

Recombinant Protein

products full name :

Recombinant Human Transferrin receptor protein 1

products short name :

Transferrin receptor protein 1

products name syn :

T9p90; CD71

other names :

transferrin receptor protein 1 isoform 1; Transferrin receptor protein 1; transferrin receptor protein 1; transferrin receptor; T9; p90; CD_antigen: CD71

products gene name :

TFRC

products gene name syn :

sTfR

other gene names :

TFRC; TFRC; T9; TR; TFR; p90; CD71; TFR1; TRFR; TR; TfR; TfR1; Trfr; sTfR

uniprot entry name :

TFR1_HUMAN

host :

E Coli

sequence positions :

94-754

sequence length :

760

sequence :

PKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLS
EKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVEN
QFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV
YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTP
VNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKF
PIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSS
GLPNIPVQTISRAAAEKLFGN

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system. A second ligand, the heditary hochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. 1 Publication

products references :

Primary structure of human transferrin receptor deduced from the mRNA sequence.Schneider C., Owen M.J., Banville D., Williams J.G.Nature 311:675-678(1984) The human transferrin receptor gene genomic organization, and the complete primary structure of the receptor deduced from a cDNA sequence.McClelland A., Kuhn L.C., Ruddle F.H.Cell 39:267-274(1984) Exon/intron structure of the human transferrin receptor gene.Evans P., Kemp J.Gene 199:123-131(1997) Molecular and evolutionary studies of the transferrin receptor.Wheeler D.L.Thesis (1999) , University of Iowa, United States Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. NIEHS SNPs program

ncbi gi num :

189458819

ncbi acc num :

NP_001121620.1

ncbi gb acc num :

NM_001128148.2

uniprot acc num :

P02786

ncbi mol weight :

101.3kD

ncbi pathways :

Clathrin Derived Vesicle Budding Pathway (1269881); Endocytosis Pathway (102279); Endocytosis Pathway (102181); FOXA2 And FOXA3 Transcription Factor Networks Pathway (137911); Golgi Associated Vesicle Biogenesis Pathway (1269882); HIF-1 Signaling Pathway (695200); HIF-1-alpha Transcription Factor Network Pathway (138045); Hematopoietic Cell Lineage Pathway (83078); Hematopoietic Cell Lineage Pathway (489); Iron Metabolism In Placenta Pathway (672461)

ncbi summary :

This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]

uniprot summary :

TfR: the transferrin receptor. Regulates the cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied receptors into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system. Protein type: Membrane protein, integral; Receptor, misc.; Cell surface. Chromosomal Location of Human Ortholog: 3q29. Cellular Component: basolateral plasma membrane; cell surface; coated pit; cytoplasmic membrane-bound vesicle; endosome; external side of plasma membrane; extracellular region; extracellular space; integral to plasma membrane; intracellular membrane-bound organelle; melanosome; membrane; mitochondrion; perinuclear region of cytoplasm; plasma membrane; recycling endosome; recycling endosome membrane. Molecular Function: chaperone binding; double-stranded RNA binding; glycoprotein binding; Hsp70 protein binding; identical protein binding; protein binding; protein homodimerization activity; transferrin receptor activity; transferrin transmembrane transporter activity; viral receptor activity. Biological Process: acute-phase response; aging; cellular iron ion homeostasis; entry of virus into host cell; osteoclast differentiation; positive regulation of bone resorption; receptor-mediated endocytosis; regulation of cell growth; regulation of cell proliferation; response to copper ion; response to hypoxia; response to iron ion; response to manganese ion; response to nutrient; response to retinoic acid; transferrin transport; transmembrane transport

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

410

size3 :

0.5 mg (E-Coli)

price3 :

665

size4 :

1 mg (E-Coli)

price4 :

1050

more info or order :

MyBioSource product webpage