Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein | MyBioSource MBS717410 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein

catalog :

MBS717410

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717410

products type :

Recombinant Protein

products full name :

Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein

products short name :

HLA class I histocompatibility antigen, alpha chain G

products name syn :

HLA G antigen; MHC class I antigen G

other names :

HLA class I histocompatibility antigen, alpha chain G; HLA class I histocompatibility antigen, alpha chain G; HLA G antigen; MHC class I antigen G

products gene name :

HLA-G

products gene name syn :

HLA-6.0; HLAG

other gene names :

HLA-G; HLA-6.0; HLAG

uniprot entry name :

HLAG_HUMAN

host :

E Coli

sequence positions :

25-337; Partial.

sequence length :

337

sequence :

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSD
SACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNL
QTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYA
YDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQR
RAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVF
DYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETR
PAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLR
WKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKS
S

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.

products references :

The mRNA of a human class I gene HLA G/HLA 6.0 exhibits a restricted pattern of expression.Shukla H., Swaroop A., Srivastava R., Weissman S.M.Nucleic Acids Res. 18:2189-2189(1990) A human major histocompatibility complex class I gene that encodes a protein with a shortened cytoplasmic segment.Geraghty D.E., Koller B.H., Orr H.T.Proc. Natl. Acad. Sci. U.S.A. 84:9145-9149(1987) Ishitani A., Geraghty D.E. A 356-Kb sequence of the subtelomeric part of the MHC class I region.Hampe A., Coriton O., Andrieux N., Carn G., Lepourcelet M., Mottier S., Dreano S., Gatius M.T., Hitte C., Soriano N., Galibert F.DNA Seq. 10:263-299(1999) Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H.Disulfide bond-mediated dimerization of HLA-G on the cell surface.Boyson J.E., Erskine R., Whitman M.C., Chiu M., Lau J.M., Koopman L.A., Valter M.M., Angelisova P., Horejsi V., Strominger J.L.Proc. Natl. Acad. Sci. U.S.A. 99:16180-16185(2002) Crystal structure of HLA-G a nonclassical MHC class I molecule expressed at the fetal-maternal interface.Clements C.S., Kjer-Nielsen L., Kostenko L., Hoare H.L., Dunstone M.A., Moses E., Freed K., Brooks A.G., Rossjohn J., McCluskey J.Proc. Natl. Acad. Sci. U.S.A. 102:3360-3365(2005) Efficient leukocyte Ig-like receptor signaling and crystal structure of disulfide-linked HLA-G dimer.Shiroishi M., Kuroki K., Ose T., Rasubala L., Shiratori I., Arase H., Tsumoto K., Kumagai I., Kohda D., Maenaka K.J. Biol. Chem. 281:10439-10447(2006)

ncbi gi num :

4504415

ncbi acc num :

NP_002118.1

ncbi gb acc num :

NM_002127.5

uniprot acc num :

P17693

ncbi mol weight :

62.9kD

ncbi pathways :

Adaptive Immune System Pathway (1269171); Allograft Rejection Pathway (920963); Allograft Rejection Pathway (83123); Allograft Rejection Pathway (535); Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway (1269194); Antigen Processing And Presentation Pathway (83074); Antigen Processing And Presentation Pathway (485); Antigen Processing-Cross Presentation Pathway (1269195); Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533)

uniprot summary :

HLA-G: Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells. Belongs to the MHC class I family. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 6p21.3. Cellular Component: early endosome membrane; Golgi membrane; membrane; MHC class I protein complex; phagocytic vesicle membrane; plasma membrane. Molecular Function: antigen binding; peptide antigen binding; protein homodimerization activity; receptor binding. Biological Process: antigen processing and presentation; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; antigen processing and presentation of peptide antigen via MHC class I; cellular defense response; cytokine and chemokine mediated signaling pathway; immune response-inhibiting cell surface receptor signaling pathway; negative regulation of immune response; negative regulation of T cell proliferation; positive regulation of interleukin-12 production; positive regulation of regulatory T cell differentiation; positive regulation of T cell tolerance induction; positive regulation of tolerance induction; regulation of immune response. Disease: Asthma, Susceptibility To

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage