Recombinant Human T-cell surface glycoprotein CD3 epsilon chain | MyBioSource MBS717406 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain

catalog :

MBS717406

quantity :

0.05 mg (E-Coli)

price :

190 USD

product information

catalog number :

MBS717406

products type :

Recombinant Protein

products full name :

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain

products short name :

T-cell surface glycoprotein CD3 epsilon chain

products name syn :

T-cell surface antigen T3/Leu-4 epsilon chain; CD3e

other names :

T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 epsilon chain; CD3e molecule; T-cell surface antigen T3/Leu-4 epsilon chain; CD_antigen: CD3e

products gene name :

CD3E

other gene names :

CD3E; CD3E; T3E; TCRE; IMD18; T3E

uniprot entry name :

CD3E_HUMAN

host :

E Coli

sequence positions :

23-207

sequence length :

207

sequence :

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQH
NDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP
RGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDIC
ITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKE
RPPPVPNPDYEPIRKGQRDLYSGLNQRRI

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

The CD3 complex mediates signal transduction.

products references :

Isolation of cDNA clones encoding the 20K non-glycosylated polypeptide chain of the human T-cell receptor/T3 complex.Gold D.P., Puck J.M., Pettey C.L., Cho M., Coligan J., Woody J.N., Terhorst C.Nature 321:431-434(1986) Terhorst C.Human CD3-epsilon gene contains three miniexons and is transcribed from a non-TATA promoter.Clevers H.C., Dunlap S., Wileman T.E., Terhorst C.Proc. Natl. Acad. Sci. U.S.A. 85:8156-8160(1988) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

ncbi gi num :

4502671

ncbi acc num :

NP_000724.1

ncbi gb acc num :

NM_000733.3

uniprot acc num :

P07766

ncbi mol weight :

48.1kD

ncbi pathways :

Adaptive Immune System Pathway (1269171); CXCR4-mediated Signaling Events Pathway (137910); Chagas Disease (American Trypanosomiasis) Pathway (147809); Chagas Disease (American Trypanosomiasis) Pathway (147795); Costimulation By The CD28 Family Pathway (1269177); Downstream TCR Signaling Pathway (1269176); Downstream Signaling In Naive CD8+ T Cells Pathway (138018); Generation Of Second Messenger Molecules Pathway (1269175); HTLV-I Infection Pathway (373901); HTLV-I Infection Pathway (373889)

ncbi summary :

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008]

uniprot summary :

CD3E: a T cell surface glycoprotein that is a component of the T cell antigen receptor. The recruitment of Nck by CD3 epsilon reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation. Contains 1 immunoglobulin-like domain and 1 ITAM domain. Protein type: Receptor, misc.; Membrane protein, integral. Chromosomal Location of Human Ortholog: 11q23. Cellular Component: alpha-beta T cell receptor complex; external side of plasma membrane; immunological synapse; integral to plasma membrane; intercellular junction; intracellular; plasma membrane; T cell receptor complex. Molecular Function: protein binding; protein heterodimerization activity; protein kinase binding; receptor signaling complex scaffold activity; receptor signaling protein activity; SH3 domain binding; T cell receptor binding; transmembrane receptor activity. Biological Process: cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway; negative regulation of smoothened signaling pathway; negative thymic T cell selection; positive regulation of alpha-beta T cell proliferation; positive regulation of calcium-mediated signaling; positive regulation of interferon-gamma production; positive regulation of interleukin-2 biosynthetic process; positive regulation of interleukin-4 production; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of T cell anergy; positive regulation of T cell proliferation; protein complex assembly; regulation of apoptosis; regulation of immune response; response to nutrient; signal complex assembly; T cell activation; T cell costimulation; T cell receptor signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway. Disease: Immunodeficiency 18

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180