product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant E Coli 50S ribosomal protein L31
catalog :
MBS717394
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717394
products type :
Recombinant Protein
products full name :
Recombinant E Coli 50S ribosomal protein L31
products short name :
50S ribosomal protein L31
other names :
50S ribosomal subunit protein L31; 50S ribosomal protein L31; 50S ribosomal subunit protein L31
products gene name :
L31
products gene name syn :
rpmE; b3936; JW3907
other gene names :
rpmE; rpmE; ECK3928; JW3907
uniprot entry name :
RL31_ECOLI
host :
E Coli
sequence positions :
Jan-70
sequence length :
70
sequence :
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSK
CHPFFTGKQRDVATGGRVDRFNKRFNIPGSK
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Binds the 23S rRNA.
products references :
Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes.Plunkett G. III, Burland V., Daniels D.L., Blattner F.R.Nucleic Acids Res. 21:3391-3398(1993) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Primary structure of Escherichia coli ribosomal protein L31.Brosius J.Biochemistry 17:501-508(1978) Small genes/gene-products in Escherichia coli K-12.Wasinger V.C., Humphery-Smith I.FEMS Microbiol. Lett. 169:375-382(1998) Characterization of Escherichia coli 50S ribosomal protein L31.Eistetter A.J., Butler P.D., Traut R.R., Fanning T.G.FEMS Microbiol. Lett. 180:345-349(1999) Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999) Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli.Zhang J., Sprung R., Pei J., Tan X., Kim S., Zhu H., Liu C.F., Grishin N.V., Zhao Y.Mol. Cell. Proteomics 8:215-225(2009) Characterization of Zn(II) -responsive ribosomal proteins YkgM and L31 in E. coli.Hensley M.P., Gunasekera T.S., Easton J.A., Sigdel T.K., Sugarbaker S.A., Klingbeil L., Breece R.M., Tierney D.L., Crowder M.W.J. Inorg. Biochem. 111:164-172(2012) Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005)
ncbi gi num :
16131774
ncbi acc num :
NP_418371.1
ncbi gb acc num :
NC_000913.3
uniprot acc num :
P0A7M9
ncbi mol weight :
35.3kD
ncbi pathways :
Ribosome Pathway (1120); Ribosome Pathway (441); Ribosome, Bacteria Pathway (405222); Ribosome, Bacteria Pathway (890454)
ncbi summary :
The L31 protein is a component of the 50S subunit of the ribosome. [More information is available at EcoCyc: EG10889].
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!