catalog number :
MBS717378
products type :
Recombinant Protein
products full name :
Recombinant human BTB/POZ domain-containing protein 2 protein
products short name :
BTB/POZ domain-containing protein 2
other names :
BTB/POZ domain-containing protein 2; BTB/POZ domain-containing protein 2; BTB/POZ domain-containing protein 2; BTB (POZ) domain containing 2
other gene names :
BTBD2; BTBD2
uniprot entry name :
BTBD2_HUMAN
sequence :
MTIEEFAAGPAQSGILVDREVVSLFLHFTVNPKPRVEFI
DRPRCCLRGKECSINRFQQVESRWGYSGTSDRIRFSVNK
RIFVVGFGLYGSIHGPTDYQVNIQIIHTDSNTVLGQNDT
GFSCDGSASTFRVMFKEPVEVLPNVNYTACATLKGPDSH
YGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSVEDG
QIPEVIFYT
storage stability :
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
tested application :
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
products description :
Interacts with topoisomerase 1 and with TRIM5 isoform Delta.
ncbi acc num :
NP_060267.2
ncbi gb acc num :
NM_017797.3
ncbi summary :
The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. [provided by RefSeq, Jul 2008]
uniprot summary :
Subunit structure: Interacts with topoisomerase 1 and with TRIM5 isoform Delta. Ref.1 Ref.7. Subcellular location: Cytoplasm P-body. Note: Cytoplasmic bodies. Ref.7. Sequence similarities: Contains 1 BTB (POZ) domain. Sequence caution: The sequence AAC16070.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence BAB55143.1 differs from that shown. Reason: Erroneous initiation.