Recombinant Human Annexin A6 protein | MyBioSource MBS717366 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Annexin A6 protein

catalog :

MBS717366

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717366

products type :

Recombinant Protein

products full name :

Recombinant Human Annexin A6 protein

products short name :

Annexin A6

products name syn :

67 kDa calelectrin; Annexin VI; Annexin-6; Calphobindin-II; CPB-II; Chromobindin-20; Lipocortin VI; Protein III; p68; p70

other names :

annexin A6 isoform 1; Annexin A6; annexin A6; annexin A6; 67 kDa calelectrin; Annexin VI; Annexin-6; Calphobindin-II; CPB-II; Chromobindin-20; Lipocortin VI; Protein III; p68; p70

products gene name :

ANX6

other gene names :

ANXA6; ANXA6; ANX6; CBP68; ANX6; CPB-II

uniprot entry name :

ANXA6_HUMAN

host :

E Coli

sequence positions :

2-245

sequence length :

673

sequence :

AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDK
EAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELT
GKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEI
LASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKM
LVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDE
AQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELS
GDFEKLMLAVVKCIR

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Signal Transduction

products description :

May associate with CD21. May regulate the release of Ca2+ from intracellular stores.

products references :

Primary structure of the human, membrane-associated Ca2+-binding protein p68 a novel member of a protein family.Crompton M.R., Owens R.J., Totty N.F., Moss S.E., Waterfield M.D., Crumpton M.J.EMBO J. 7:21-27(1988) Human 67-kDa calelectrin contains a duplication of four repeats found in 35-kDa lipocortins.Suedhof T.C., Slaughter C.A., Leznicki I., Barjon P., Reynolds G.A.Proc. Natl. Acad. Sci. U.S.A. 85:664-668(1988) Structure and expression of cDNA for calphobindin II, a human placental coagulation inhibitor.Iwasaki A., Suda M., Watanabe M., Nakao H., Hattori Y., Nagoya T., Saino Y., Shidara Y., Maki M.J. Biochem. 106:43-49(1989) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence and comparative analysis of human chromosome 5.Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S., Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.Nature 431:268-274(2004)

ncbi gi num :

71773329

ncbi acc num :

NP_001146.2

ncbi gb acc num :

NM_001155.4

uniprot acc num :

P08133

ncbi mol weight :

55.4kD

ncbi pathways :

Calcium Regulation In The Cardiac Cell Pathway (198906); Muscle Contraction Pathway (1269868); Prostaglandin Synthesis And Regulation Pathway (198912); Smooth Muscle Contraction Pathway (1269870)

ncbi summary :

Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]

uniprot summary :

ANXA6: a calcium/phospholipid-binding protein that may associate with CD21. May regulate the release of Ca(2+) from intracellular stores. Phosphorylated in response to growth factor stimulation. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion. Protein type: Lipid-binding; Motility/polarity/chemotaxis; Calcium-binding. Chromosomal Location of Human Ortholog: 5q33.1. Cellular Component: apical plasma membrane; focal adhesion; late endosome membrane; lysosomal membrane; melanosome; membrane; mitochondrion; nucleus; perinuclear region of cytoplasm; protein complex; sarcolemma. Molecular Function: calcium ion binding; calcium-dependent phospholipid binding; calcium-dependent protein binding; cholesterol binding; GTP binding; ligand-gated ion channel activity; lipid binding; protein binding; protein complex binding; protein homodimerization activity. Biological Process: calcium ion transport; mitochondrial calcium ion homeostasis; muscle contraction; protein homooligomerization; regulation of muscle contraction

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage