product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant E.coli 30S ribosomal protein S10
catalog :
MBS717365
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717365
products type :
Recombinant Protein
products full name :
Recombinant E.coli 30S ribosomal protein S10
products short name :
30S ribosomal protein S10
products name syn :
Recombinant E.coli 30S ribosomal protein S10 protein
other names :
30S ribosomal protein S10; 30S ribosomal protein S10
other gene names :
Ccan_04410
host :
E Coli
sequence :
MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGP
IPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVE
PTEKTVDALMRLDLAAGVDVQISLG
purity :
0.9
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: GST-tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Involved in the binding of tRNA to the ribosomes. HAMAP MF_00508
products references :
[1] "The primary structure of protein S10 from the small ribosomal subunit of Escherichia coli.
ncbi gi num :
340621219
ncbi acc num :
YP_004739670.1
ncbi gb acc num :
NC_015846.1
ncbi mol weight :
38 KD
ncbi pathways :
Ribosome Pathway 538629!!Ribosome Pathway 441!!Ribosome, Bacteria Pathway 539858
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!