product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Ras-related protein Rab-8A
catalog :
MBS717349
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS717349
products type :
Recombinant Protein
products full name :
Recombinant Human Ras-related protein Rab-8A
products short name :
Ras-related protein Rab-8A
products name syn :
Oncogene c-mel
other names :
ras-related protein Rab-8A; Ras-related protein Rab-8A; ras-related protein Rab-8A; RAB8A, member RAS oncogene family; Oncogene c-mel
products gene name :
RAB8A
products gene name syn :
MEL; RAB8
other gene names :
RAB8A; RAB8A; MEL; RAB8; MEL; RAB8
uniprot entry name :
RAB8A_HUMAN
host :
E Coli
sequence positions :
3-193
sequence length :
207
sequence :
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTI
GIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRG
AMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMIL
GNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINV
ENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Transport
products description :
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. That Rab is involved in polarized vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization. Plays an important role in ciliogenesis. Together with MICALL2, may also regulate adherens junction assembly. May play a role in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore play a role in glucose homeostasis.
products references :
A small rab GTPase is distributed in cytoplasmic vesicles in non polarized cells but colocalizes with the tight junction marker ZO-1 in polarized epithelial cells.Zahraoui A., Joberty G., Arpin M., Fontaine J.J., Hellio R., Tavitian A., Louvard D.J. Cell Biol. 124:101-115(1994)
ncbi gi num :
16933567
ncbi acc num :
NP_005361.2
ncbi gb acc num :
NM_005370.4
uniprot acc num :
P61006
ncbi mol weight :
49.1kD
ncbi pathways :
AMPK Signaling Pathway (989139); AMPK Signaling Pathway (992181); Anchoring Of The Basal Body To The Plasma Membrane Pathway (1268847); Assembly Of The Primary Cilium Pathway (1268846); Cargo Trafficking To The Periciliary Membrane Pathway (1268848); Cell Cycle Pathway (1269741); Cell Cycle, Mitotic Pathway (1269763); Endocytosis Pathway (102279); Endocytosis Pathway (102181); G2/M Transition Pathway (1269799)
ncbi summary :
The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. [provided by RefSeq, Jul 2008]
uniprot summary :
RAB8A: May be involved in vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization. Interacts with MAP4K2 and SYTL4. Interacts with SGSM1 and SGSM3. Interacts with OPTN. Interacts with RAB3IP. Interacts with MYO5B. Interacts with PIFO/C1orf88. Interacts with BIRC6/bruce. Interacts with OCRL. Belongs to the small GTPase superfamily. Rab family. Protein type: G protein, monomeric; G protein; Oncoprotein; G protein, monomeric, Rab; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 19p13.1. Cellular Component: cell soma; centriole; centrosome; cilium; cytoplasmic vesicle membrane; cytosol; dendrite; Golgi membrane; nonmotile primary cilium; nucleolus; nucleus; phagocytic vesicle; phagocytic vesicle membrane; plasma membrane; postsynaptic density; recycling endosome membrane; synaptic vesicle; trans-Golgi network transport vesicle. Molecular Function: GDP binding; GTP binding; GTPase activity; myosin V binding; protein binding; protein kinase binding; Rab GTPase binding. Biological Process: axonogenesis; cellular response to insulin stimulus; cilium biogenesis; G2/M transition of mitotic cell cycle; Golgi vesicle fusion to target membrane; mitotic cell cycle; organelle organization and biogenesis; protein secretion; regulation of long-term neuronal synaptic plasticity; regulation of protein transport; small GTPase mediated signal transduction; vesicle docking during exocytosis
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!