protein

Recombinant Human Cation-independent mannose-6-phosphate receptor

MBS717344

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Cation-independent mannose-6-phosphate receptor

Cation-independent mannose-6-phosphate receptor

46 kDa mannose 6-phosphate receptor; MPR 46

cation-dependent mannose-6-phosphate receptor isoform 1; Cation-dependent mannose-6-phosphate receptor; cation-dependent mannose-6-phosphate receptor; mannose-6-phosphate receptor (cation dependent); 46 kDa mannose 6-phosphate receptor; MPR 46

MPRI

M6PR; M6PR; SMPR; MPR46; CD-MPR; MPR 46; MPR-46; MPR46; MPRD; CD Man-6-P receptor; CD-MPR; MPR 46

MPRD_HUMAN

E Coli

2328-2491

277

KKERRETVISKLTTCCRRSSNVSYKYSKVNKEEETDENE
TEWLMEEIQLPPPRQGKEGQENGHITTKSVKALSSLHGD
DQDSEDEVLTIPEVKVHSGRGAGAESSHPVRNAQSNALQ
EREDDRVGLVRGEKARKGKSSSAQQKTVSSTKLVSFHDD
SDEDLLHI

Greater than 90% as determined by SDS-PAGE.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Transport

Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex.

Cloning of a cDNA encoding the human cation-dependent mannose 6-phosphate-specific receptor.Pohlmann R., Nagel G., Schmidt B., Stein M., Lorkowski G., Krentler C., Cully J., Meyer H.E., Grzeschik K.H., Mersmann G., Hasilik A., von Figura K.Proc. Natl. Acad. Sci. U.S.A. 84:5575-5579(1987) Isolation and analysis of the human 46-kDa mannose 6-phosphate receptor gene.Klier H.J., von Figura K., Pohlmann R.Eur. J. Biochem. 197:23-28(1991) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

4505061

NP_002346.1

NM_002355.3

P20645

45.7kD

Clathrin Derived Vesicle Budding Pathway (1269881); Lysosome Pathway (99052); Lysosome Pathway (96865); Lysosome Vesicle Biogenesis Pathway (1269883); Membrane Trafficking Pathway (1269877); Phagosome Pathway (153910); Phagosome Pathway (153859); Vesicle-mediated Transport Pathway (1269876); Trans-Golgi Network Vesicle Budding Pathway (1269880)

This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, May 2011]

M6PR: Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6- phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 12p13. Cellular Component: endosome; integral to plasma membrane; late endosome; lysosomal membrane; membrane; perinuclear region of cytoplasm; trans-Golgi network. Molecular Function: mannose binding; mannose transmembrane transporter activity; transmembrane receptor activity. Biological Process: endosome to lysosome transport; mannose transport; receptor-mediated endocytosis; signal transduction

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180