product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Mitochondrial 2-oxoglutarate/malate carrier protein
catalog :
MBS717341
quantity :
0.05 mg
price :
195 USD
more info or order :
product information
catalog number :
MBS717341
products type :
Recombinant Protein
products full name :
Recombinant human Mitochondrial 2-oxoglutarate/malate carrier protein
products short name :
Mitochondrial 2-oxoglutarate/malate carrier protein
products name syn :
Recombinant human Mitochondrial 2-oxoglutarate/malate carrier protein
other names :
mitochondrial 2-oxoglutarate/malate carrier protein isoform 1; Mitochondrial 2-oxoglutarate/malate carrier protein; mitochondrial 2-oxoglutarate/malate carrier protein; OGCP; solute carrier family 25 member 11; solute carrier family 20 (oxoglutarate carrier), member 4; solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11; Solute carrier family 25 member 11
other gene names :
SLC25A11; SLC25A11; OGC; SLC20A4; SLC20A4; OGCP
uniprot entry name :
M2OM_HUMAN
host :
E Coli
sequence :
DLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIY
T
T
purity :
0.9
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: GST tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.
products references :
[1] "Sequences of the human and bovine genes for the mitochondrial 2-oxoglutarate carrier.
ncbi gi num :
21361114
ncbi acc num :
NP_003553.2
ncbi gb acc num :
NM_003562.4
uniprot acc num :
Q02978
ncbi mol weight :
31 KD
ncbi pathways :
Gluconeogenesis Pathway 106204!!Glucose Metabolism Pathway 106199!!Metabolism Pathway 477135!!Metabolism Of Carbohydrates Pathway 106196
ncbi summary :
The oxoglutarate/malate carrier transports 2-oxoglutarate across the inner membranes of mitochondria in an electroneutral exchange for malate or other dicarboxylic acids (summary by Iacobazzi et al., 1992 [PubMed 1457818]).[supplied by OMIM, Jan 2011]
uniprot summary :
Function: Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism. Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein. Sequence similarities: Belongs to the mitochondrial carrier family.Contains 3 Solcar repeats.
size :
0.05 mg
price :
195 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!