Recombinant human Actin, cytoplasmic 1 protein | MyBioSource MBS717330 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant human Actin, cytoplasmic 1 protein

catalog :

MBS717330

quantity :

0.01 mg

price :

135 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717330

products type :

Recombinant Protein

products full name :

Recombinant human Actin, cytoplasmic 1 protein

products short name :

Actin, cytoplasmic 1

products name syn :

Beta-actin

other names :

Actin, cytoplasmic 1; Actin, cytoplasmic 1; actin, cytoplasmic 1; beta cytoskeletal actin; PS1TP5-binding protein 1; actin, beta; Beta-actin

other gene names :

ACTB; ACTB; BRWS1; PS1TP5BP1

uniprot entry name :

ACTB_HUMAN

host :

E Coli

sequence :

DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHH
TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF
NTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIY
EGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE
REIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPD
GQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM
KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP
STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE
YDESGPSIVHRKCF

purity :

90%

storage stability :

Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.

tested application :

SDS-PAGE, ELISA (EIA)

products description :

Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

ncbi gi num :

46397333

ncbi acc num :

P60709.1

uniprot acc num :

P60709

ncbi mol weight :

67 KD

ncbi pathways :

Adherens Junction Pathway (83070); Adherens Junction Pathway (481); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (117293); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (116129); Bacterial Invasion Of Epithelial Cells Pathway (149807); Bacterial Invasion Of Epithelial Cells Pathway (148661); Chaperonin-mediated Protein Folding Pathway (106242); Cooperation Of Prefoldin And TriC/CCT In Actin And Tubulin Folding Pathway (106243); Dilated Cardiomyopathy Pathway (121494); Dilated Cardiomyopathy Pathway (121285)

ncbi summary :

This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins. [provided by RefSeq, Jul 2008]

uniprot summary :

Function: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Subunit structure: Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others. Identified in a mRNP granule complex, at least composed of ACTB, ACTN4, DHX9, ERG, HNRNPA1, HNRNPA2B1, HNRNPAB, HNRNPD, HNRNPL, HNRNPR, HNRNPU, HSPA1, HSPA8, IGF2BP1, ILF2, ILF3, NCBP1, NCL, PABPC1, PABPC4, PABPN1, RPLP0, RPS3, RPS3A, RPS4X, RPS8, RPS9, SYNCRIP, TROVE2, YBX1 and untranslated mRNAs. Component of the BAF complex, which includes at least actin (ACTB), ARID1A, ARID1B/BAF250, SMARCA2, SMARCA4/BRG1, ACTL6A/BAF53, ACTL6B/BAF53B, SMARCE1/BAF57 SMARCC1/BAF155, SMARCC2/BAF170, SMARCB1/SNF5/INI1, and one or more of SMARCD1/BAF60A, SMARCD2/BAF60B, or SMARCD3/BAF60C. In muscle cells, the BAF complex also contains DPF3. Found in a complex with XPO6, Ran, ACTB and PFN1. Component of the MLL5-L complex, at least composed of MLL5, STK38, PPP1CA, PPP1CB, PPP1CC, HCFC1, ACTB and OGT. Interacts with XPO6 and EMD. Interacts with ERBB2. Interacts with GCET2. Ref.11 Ref.12 Ref.15 Ref.22. Subcellular location: Cytoplasm cytoskeleton. Note: Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Ref.17. Post-translational modification: ISGylated. Ref.13Oxidation of Met-44 by MICALs (MICAL1, MICAL2 or MICAL3) to form methionine sulfoxide promotes actin filament depolymerization. Methionine sulfoxide is produced stereospecifically, but it is not known whether the (S)-S-oxide or the (R)-S-oxide is produced . By similarity. Involvement in disease: Defects in ACTB are a cause of dystonia juvenile-onset (DYTJ) [. MIM:607371]. DYTJ is a form of dystonia with juvenile onset. Dystonia is defined by the presence of sustained involuntary muscle contraction, often leading to abnormal postures. DYTJ patients manifest progressive, generalized, dopa-unresponsive dystonia, developmental malformations and sensory hearing loss. Ref.23Defects in ACTB are the cause of Baraitser-Winter syndrome type 1 (BRWS1) [. MIM:243310]. A rare developmental disorder characterized by the combination of congenital ptosis, high-arched eyebrows, hypertelorism, ocular colobomata, and a brain malformation consisting of anterior-predominant lissencephaly. Other typical features include postnatal short stature and microcephaly, intellectual disability, seizures, and hearing loss. Ref.25. Miscellaneous: In vertebrates 3 main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins coexist in most cell types as components of the cytoskeleton and as mediators of internal cell motility. Sequence similarities: Belongs to the actin family.

size1 :

0.01 mg

price1 :

135 USD

size2 :

0.05 mg

price2 :

195

size3 :

0.2 mg

price3 :

465

size4 :

0.5 mg

price4 :

815

size5 :

1 mg

price5 :

1290

more info or order :

MyBioSource product webpage