product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant mouse C-X-C motif chemokine 2 protein
catalog :
MBS717320
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717320
products type :
Recombinant Protein
products full name :
Recombinant mouse C-X-C motif chemokine 2 protein
products short name :
C-X-C motif chemokine 2 protein
products name syn :
Recombinant mouse C-X-C motif chemokine 2 protein
other names :
C-X-C motif chemokine 2; C-X-C motif chemokine 2; C-X-C motif chemokine 2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; chemokine (C-X-C motif) ligand 2; Growth-regulated protein beta; Gro-beta; Macrophage inflammatory protein 2-alpha; MIP2-alphaCleaved into the following chain:GRO-beta(5-73); Alternative name(s):; GRO-beta-T; Hematopoietic synergistic factor; HSF; SB-251353
other gene names :
CXCL2; CXCL2; GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a; GRO2; GROB; MIP2A; SCYB2; Gro-beta; MIP2-alpha; HSF
uniprot entry name :
CXCL2_HUMAN
host :
E Coli
sequence :
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTE
VIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
purity :
0.9
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: His tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.
products references :
[1] "Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues.
ncbi gi num :
4504155
ncbi acc num :
NP_002080.1
ncbi gb acc num :
NM_002089.3
uniprot acc num :
P19875
ncbi mol weight :
15 KD
ncbi pathways :
Chemokine Receptors Bind Chemokines Pathway 106359!!Chemokine Signaling Pathway 99051!!Chemokine Signaling Pathway 96864!!Class A/1 (Rhodopsin-like Receptors) Pathway 106357!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Cytokines And Inflammatory Response Pathway 198794!!G Alpha (i) Signalling Events Pathway 119550!!GPCR Downstream Signaling Pathway 119548!!GPCR Ligand Binding Pathway 161020
uniprot summary :
Function: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. Ref.9. Subcellular location: Secreted. Post-translational modification: The N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells. Pharmaceutical use: GRO-beta(5-73) is available under the name Garnocestim as immunomodulator. It is used prior to hematopoietic transplantation for peripheral blood stem cell mobilization and reduction of incidence, duration, and/or severity of chemotherapy induced cytopenias. Sequence similarities: Belongs to the intercrine alpha (chemokine CxC) family.
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!