protein

Recombinant human Insulin-like growth factor II protein

MBS717318

0.05 mg

195 USD

Recombinant Protein

Recombinant human Insulin-like growth factor II protein

Insulin-like growth factor II protein

insulin-like growth factor II; Insulin-like growth factor II; insulin-like growth factor II; somatomedin-A; insulin-like growth factor type 2; insulin-like growth factor 2 (somatomedin A); Somatomedin-A

IGF2; IGF2; IGF-II; PP9974; C11orf43; IGF-II

IGF2_HUMAN

E Coli

ETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVE
ECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPR
YPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKEL
EAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK

Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

189955

AAA60088.1

P01344

44 KD

Apoptosis Pathway 198797!!Diabetes Pathways 105902!!Disease Pathway 530764!!Endochondral Ossification Pathway 198812!!Hedgehog Signaling Pathway 198835!!Regulation Of Insulin-like Growth Factor (IGF) Activity By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway 105908

This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]

Function: The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development. Ref.27Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3. Ref.27. Subcellular location: Secreted. Post-translational modification: O-glycosylated with core 1 or possibly core 8 glycans. Thr-96 is a minor glycosylation site compared to Thr-99. Ref.26 Ref.29 Ref.30. Polymorphism: Genetic variations in IGF2 are associated with body mass index (BMI). The BMI is a statistical measurement which compares a person's weight and height. Involvement in disease: Epigenetic changes of DNA hypomethylation in IGF2 are a cause of Silver-Russell syndrome (SRS) [. MIM:180860]. A clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations. The phenotypic expression changes during childhood and adolescence, with the facial features and asymmetry usually becoming more subtle with age. Ref.28. Sequence similarities: Belongs to the insulin family. Mass spectrometry: Molecular mass is 7469.4 Da from positions 25 - 91. Determined by MALDI. Ref.24 Ref.25Molecular mass is 7398.3 Da from positions 26 - 91. Determined by MALDI. Ref.24 Ref.25

0.05 mg

195 USD