product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant E.coli 30S ribosomal protein S11
catalog :
MBS717317
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717317
products type :
Recombinant Protein
products full name :
Recombinant E.coli 30S ribosomal protein S11
products short name :
30S ribosomal protein S11
products name syn :
Recombinant E.coli 30S ribosomal protein S11 protein
other names :
30S ribosomal protein S11; 30S ribosomal protein S11
other gene names :
Pedsa_2123
host :
E Coli
sequence :
AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGN
ALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGI
KNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPH
NGCRPPKKRRV
purity :
0.9
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: His-tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome
products references :
[1] "Nucleotide sequence of the alpha ribosomal protein operon of Escherichia coli.
ncbi gi num :
325104843
ncbi acc num :
YP_004274497.1
ncbi gb acc num :
NC_015177.1
ncbi mol weight :
21 KD
ncbi pathways :
Ribosome Pathway 212020!!Ribosome Pathway 441!!Ribosome, Bacteria Pathway 461449
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!