catalog number :
MBS717311
products type :
Recombinant Protein
products full name :
Recombinant human Dickkopf-related protein 3 protein
products short name :
Dickkopf-related protein 3
products name syn :
Dickkopf-1; Dkk-1; hDkk-1; SK
other names :
dickkopf-related protein 3; Dickkopf-related protein 3; dickkopf-related protein 3; dkk-3; hDkk-3; dickkopf-3; RIG-like 5-6; RIG-like 7-1; dickkopf homolog 3; regulated in glioma; dickkopf 3 homolog (Xenopus laevis)
other gene names :
DKK3; DKK3; RIG; REIC; REIC; Dickkopf-3; Dkk-3; hDkk-3
uniprot entry name :
DKK3_HUMAN
sequence :
APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMED
TQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETN
TDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGD
EEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRML
CTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQP
GLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWE
LEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQ
DGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMA
LREPAAAAAALLG
storage stability :
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
tested application :
SDS-PAGE, ELISA (EIA)
products description :
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity).
ncbi acc num :
NP_001018067.1
ncbi gb acc num :
NM_001018057.1
ncbi summary :
This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease . By similarity. Ref.1. Subunit structure: Interacts with LRP5 and LRP6 . By similarity. Subcellular location: Secreted. Tissue specificity: Highest expression in heart, brain, and spinal cord. Ref.1 Ref.4. Domain: The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6 . By similarity. Post-translational modification: N- and O-glycosylated. Ref.1 Ref.13. Sequence similarities: Belongs to the dickkopf family.