product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Dickkopf-related protein 3 protein
catalog :
MBS717311
quantity :
0.01 mg
price :
135 USD
more info or order :
product information
catalog number :
MBS717311
products type :
Recombinant Protein
products full name :
Recombinant human Dickkopf-related protein 3 protein
products short name :
Dickkopf-related protein 3
products name syn :
Dickkopf-1; Dkk-1; hDkk-1; SK
other names :
dickkopf-related protein 3; Dickkopf-related protein 3; dickkopf-related protein 3; dkk-3; hDkk-3; dickkopf-3; RIG-like 5-6; RIG-like 7-1; dickkopf homolog 3; regulated in glioma; dickkopf 3 homolog (Xenopus laevis)
other gene names :
DKK3; DKK3; RIG; REIC; REIC; Dickkopf-3; Dkk-3; hDkk-3
uniprot entry name :
DKK3_HUMAN
host :
E Coli
sequence :
APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMED
TQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETN
TDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGD
EEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRML
CTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQP
GLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWE
LEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQ
DGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMA
LREPAAAAAALLG
purity :
>90%(SDS-PAGE)
storage stability :
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
tested application :
SDS-PAGE, ELISA (EIA)
products description :
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity).
ncbi gi num :
66346689
ncbi acc num :
NP_001018067.1
ncbi gb acc num :
NM_001018057.1
uniprot acc num :
Q9UBP4
ncbi mol weight :
65kD
ncbi summary :
This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease . By similarity. Ref.1. Subunit structure: Interacts with LRP5 and LRP6 . By similarity. Subcellular location: Secreted. Tissue specificity: Highest expression in heart, brain, and spinal cord. Ref.1 Ref.4. Domain: The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6 . By similarity. Post-translational modification: N- and O-glycosylated. Ref.1 Ref.13. Sequence similarities: Belongs to the dickkopf family.
size1 :
0.01 mg
price1 :
135 USD
size2 :
0.05 mg
price2 :
195
size3 :
0.2 mg
price3 :
465
size4 :
0.5 mg
price4 :
815
size5 :
1 mg
price5 :
1290
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!