product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Tumor necrosis factor receptor superfamily member 1A
catalog :
MBS717308
quantity :
0.05 mg
price :
195 USD
more info or order :
product information
catalog number :
MBS717308
products type :
Recombinant Protein
products full name :
Recombinant human Tumor necrosis factor receptor superfamily member 1A
products short name :
Tumor necrosis factor receptor superfamily member 1A
products name syn :
Recombinant human Tumor necrosis factor receptor superfamily member 1A protein
other names :
tumor necrosis factor receptor superfamily member 1A; Tumor necrosis factor receptor superfamily member 1A; tumor necrosis factor receptor superfamily member 1A; TNF-R1; TNF-RI; TNFR-I; tumor necrosis factor-alpha receptor; tumor necrosis factor receptor type 1; tumor necrosis factor binding protein 1; tumor necrosis factor receptor 1A isoform beta; tumor necrosis factor receptor superfamily, member 1A; Tumor necrosis factor receptor 1; TNF-R1; Tumor necrosis factor receptor type I; TNF-RI; TNFR-I; p55; p60
other gene names :
TNFRSF1A; TNFRSF1A; FPF; p55; p60; TBP1; TNF-R; TNFAR; TNFR1; p55-R; CD120a; TNFR55; TNFR60; TNF-R-I; TNF-R55; TNFAR; TNFR1; TNF-R1; TNF-RI; TNFR-I; TBPI
uniprot entry name :
TNR1A_HUMAN
host :
E Coli
sequence :
VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLY
NDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKE
MGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCS
LCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCK
KSLECTKLCLPQIENVKGTEDSGT
purity :
0.9
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: GST tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
products references :
[1] "Molecular cloning and expression of the human 55 kd tumor necrosis factor receptor.
ncbi gi num :
4507575
ncbi acc num :
NP_001056.1
ncbi gb acc num :
NM_001065.3
uniprot acc num :
P19438
ncbi mol weight :
46 KD
ncbi pathways :
Adipocytokine Signaling Pathway 83093!!Adipocytokine Signaling Pathway 505!!Alzheimer's Disease Pathway 83097!!Alzheimer's Disease Pathway 509!!Amyotrophic Lateral Sclerosis (ALS) Pathway 83099!!Amyotrophic Lateral Sclerosis (ALS) Pathway 511!!Apoptosis Pathway 198797!!Apoptosis Pathway 83060!!Apoptosis Pathway 470!!Apoptosis Pathway 105648
ncbi summary :
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. Subunit structure: Binding of TNF to the extracellular domain leads to homotrimerization. The aggregated death domains provide a novel molecular interface that interacts specifically with the death domain of TRADD. Various TRADD-interacting proteins such as TRAFS, RIPK1 and possibly FADD, are recruited to the complex by their association with TRADD. This complex activates at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4, BRE, FEM1B, GRB2, SQSTM1 and TRPC4AP. Interacts with HCV core protein. Interacts with human cytomegalovirus/HHV-5 protein UL138. Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19. Subcellular location: Cell membrane; Single-pass type I membrane protein. Secreted. Domain: The domain that induces A-SMASE is probably identical to the death domain. The N-SMASE activation domain (NSD) is both necessary and sufficient for activation of N-SMASE.Both the cytoplasmic membrane-proximal region and the C-terminal region containing the death domain are involved in the interaction with TRPC4AP . By similarity. Post-translational modification: The soluble form is produced from the membrane form by proteolytic processing. Involvement in disease: Defects in TNFRSF1A are the cause of familial hibernian fever (FHF) [. MIM:142680]; also known as tumor necrosis factor receptor-associated periodic syndrome (TRAPS). FHF is a hereditary periodic fever syndrome characterized by recurrent fever, abdominal pain, localized tender skin lesions and myalgia. Reactive amyloidosis is the main complication and occurs in 25% of cases. Ref.22 Ref.23 Ref.24 Ref.25 Ref.26. Sequence similarities: Contains 1 death domain.Contains 4 TNFR-Cys repeats.
size :
0.05 mg
price :
195 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!