product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Anaphase-promoting complex subunit 5 protein
catalog :
MBS717307
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717307
products type :
Recombinant Protein
products full name :
Recombinant human Anaphase-promoting complex subunit 5 protein
products short name :
Anaphase-promoting complex subunit 5 protein
other names :
anaphase-promoting complex subunit 5 isoform b; Anaphase-promoting complex subunit 5; anaphase-promoting complex subunit 5; cyclosome subunit 5; anaphase promoting complex subunit 5; Cyclosome subunit 5
other gene names :
ANAPC5; ANAPC5; APC5; APC5; APC5
uniprot entry name :
APC5_HUMAN
host :
E Coli
sequence :
ASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVL
LNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLY
KLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDS
FSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTA
LQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSV
REEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALT
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
ncbi gi num :
213385323
ncbi acc num :
NP_001131031.1
ncbi gb acc num :
NM_001137559.1
uniprot acc num :
Q9UJX4
ncbi mol weight :
52 KD
ncbi pathways :
APC/C Complex Pathway 413481!!APC/C Complex Pathway 468395!!APC/C-mediated Degradation Of Cell Cycle Proteins Pathway 105825!!APC/C:Cdc20 Mediated Degradation Of Cyclin B Pathway 105832!!APC/C:Cdc20 Mediated Degradation Of Securin Pathway 105833!!APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway 105831!!APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway 105835!!Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway 105829!!Adaptive Immune System Pathway 366160!!Antigen Processing: Ubiquitination Proteasome Degradation Pathway 366162
ncbi summary :
This gene encodes a tetratricopeptide repeat-containing component of the anaphase promoting complex/cyclosome (APC/C), a large E3 ubiquitin ligase that controls cell cycle progression by targeting a number of cell cycle regulators such as B-type cyclins for 26S proteasome-mediated degradation through ubiquitination. The encoded protein is required for the proper ubiquitination function of APC/C and for the interaction of APC/C with transcription coactivators. It also interacts with polyA binding protein and represses internal ribosome entry site-mediated translation. Multiple transcript variants encoding different isoforms have been found for this gene. These differences cause translation initiation at a downstream AUG and result in a shorter protein (isoform b), compared to isoform a. [provided by RefSeq, Nov 2008]
uniprot summary :
Function: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Ref.7. Pathway: Protein modification; protein ubiquitination. Subunit structure: The APC/C is composed of at least 12 subunits. Ref.1. Sequence similarities: Belongs to the APC5 family.Contains 4 TPR repeats.
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!