Recombinant Human Connective tissue growth factor protein | MyBioSource MBS717306 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Connective tissue growth factor protein

catalog :

MBS717306

quantity :

0.05 mg (E-Coli)

price :

175 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717306

products type :

Recombinant Protein

products full name :

Recombinant Human Connective tissue growth factor protein

products short name :

Connective tissue growth factor

products name syn :

CCN family member 2; Hypertrophic chondrocyte-specific protein 24; Insulin-like growth factor-binding protein 8; IBP-8; IGF-binding protein 8; IGFBP-8

other names :

connective tissue growth factor; Connective tissue growth factor; connective tissue growth factor; connective tissue growth factor; CCN family member 2; Hypertrophic chondrocyte-specific protein 24; Insulin-like growth factor-binding protein 8; IBP-8; IGF-binding protein 8; IGFBP-8

products gene name :

CTGF

products gene name syn :

CCN2; HCS24; IGFBP8

other gene names :

CTGF; CTGF; CCN2; NOV2; HCS24; IGFBP8; CCN2; HCS24; IGFBP8; IBP-8; IGF-binding protein 8; IGFBP-8

uniprot entry name :

CTGF_HUMAN

host :

E Coli

sequence positions :

253-349

sequence length :

349

sequence :

GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGR
CCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCP
GDNDIFESLYYRKMYGDMA

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.

products references :

Connective tissue growth factor a cysteine-rich mitogen secreted by human vascular endothelial cells is related to the SRC-induced immediate early gene product CEF-10.Bradham D.M., Igarashi A., Potter R.L., Grotendorst G.R.J. Cell Biol. 114:1285-1294(1991)

ncbi gi num :

4503123

ncbi acc num :

NP_001892.1

ncbi gb acc num :

NM_001901.2

uniprot acc num :

P29279

ncbi mol weight :

38.5kD

ncbi pathways :

Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway (1270010); Gene Expression Pathway (1269649); Generic Transcription Pathway (1269650); Hippo Signaling Pathway (749777); Hippo Signaling Pathway (750388); Metabolism Pathway (1269956); Metabolism Of Lipids And Lipoproteins Pathway (1270001); PPARA Activates Gene Expression Pathway (1270030); Regulation Of Lipid Metabolism By Peroxisome Proliferator-activated Receptor Alpha (PPARalpha) Pathway (1270029); TGF-beta Receptor Signaling Pathway (138024)

ncbi summary :

The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis. [provided by RefSeq, Nov 2009]

uniprot summary :

CTGF: Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. Belongs to the CCN family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Cell adhesion; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 6q23.1. Cellular Component: cell cortex; cis-Golgi network; cytosol; extracellular region; extracellular space; Golgi apparatus; intracellular membrane-bound organelle; perinuclear region of cytoplasm; plasma membrane; proteinaceous extracellular matrix. Molecular Function: fibronectin binding; growth factor activity; heparin binding; insulin-like growth factor binding; integrin binding; protein binding; protein C-terminus binding. Biological Process: angiogenesis; cartilage condensation; cell adhesion; cell differentiation; cell migration; cell-cell signaling; cell-matrix adhesion; cellular lipid metabolic process; epidermis development; fibroblast growth factor receptor signaling pathway; gene expression; integrin-mediated signaling pathway; lung development; organ senescence; ossification; positive regulation of caspase activity; positive regulation of cell activation; positive regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of collagen biosynthetic process; positive regulation of JNK cascade; positive regulation of stress fiber formation; regulation of cell growth; regulation of chondrocyte differentiation; response to amino acid stimulus; response to anoxia; response to estradiol stimulus; response to glucose stimulus; response to mineralocorticoid stimulus; response to peptide hormone stimulus; response to wounding; signal transduction; tissue homeostasis; transcription initiation from RNA polymerase II promoter

size1 :

0.05 mg (E-Coli)

price1 :

175 USD

size2 :

0.2 mg (E-Coli)

price2 :

295

size3 :

0.5 mg (E-Coli)

price3 :

580

size4 :

1 mg (E-Coli)

price4 :

855

more info or order :

MyBioSource product webpage