product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant E Coli 30S ribosomal protein S3
catalog :
MBS717304
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717304
products type :
Recombinant Protein
products full name :
Recombinant E Coli 30S ribosomal protein S3
products short name :
30S ribosomal protein S3
other names :
30S ribosomal subunit protein S3; 30S ribosomal protein S3; 30S ribosomal subunit protein S3
products gene name :
rpsC
products gene name syn :
b3314; JW3276
other gene names :
rpsC; rpsC; ECK3301; JW3276
uniprot entry name :
RS3_ECOLI
host :
E Coli
sequence positions :
2-233, Full length
sequence length :
233
sequence :
GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVR
QYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGK
KGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVAD
SITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRL
GGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVI
GVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation. Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp.
products references :
Structure of the Escherichia coli S10 ribosomal protein operon.Zurawski G., Zurawski S.M.Nucleic Acids Res. 13:4521-4526(1985) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) The primary structure of protein S3 from the small ribosomal subunit of Escherichia coli.Brauer D., Roming R.FEBS Lett. 106:352-357(1979) Protein-rRNA binding features and their structural and functional implications in ribosomes as determined by cross-linking studies.Urlaub H., Kruft V., Bischof O., Mueller E.-C., Wittmann-Liebold B.EMBO J. 14:4578-4588(1995) Flexibility of the nascent polypeptide chain within the ribosome --contacts from the peptide N-terminus to a specific region of the 30S subunit.Choi K.M., Atkins J.F., Gesteland R.F., Brimacombe R.Eur. J. Biochem. 255:409-413(1998) mRNA helicase activity of the ribosome.Takyar S., Hickerson R.P., Noller H.F.Cell 120:49-58(2005) Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry.Arnold R.J., Reilly J.P.Anal. Biochem. 269:105-112(1999) All-atom homology model of the Escherichia coli 30S ribosomal subunit.Tung C.-S., Joseph S., Sanbonmatsu K.Y.Nat. Struct. Biol. 9:750-755(2002) Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement.Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003) Structures of the bacterial ribosome at 3.5 A resolution.Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005)
ncbi gi num :
16131193
ncbi acc num :
NP_417773.1
ncbi gb acc num :
NC_000913.3
uniprot acc num :
P0A7V3
ncbi mol weight :
53.2kD
ncbi pathways :
Ribosome Pathway (1120); Ribosome Pathway (441); Ribosome, Bacteria Pathway (405222); Ribosome, Bacteria Pathway (890454)
ncbi summary :
The S3 protein, a component of the small subunit of the ribosome, is surface-accessible and located on the head of the 30S subunit . [More information is available at EcoCyc: EG10902].
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!