product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Aspartate aminotransferase, mitochondrial
catalog :
MBS717285
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717285
products type :
Recombinant Protein
products full name :
Recombinant human Aspartate aminotransferase, mitochondrial
products short name :
Aspartate aminotransferase, mitochondrial
products name syn :
Recombinant human Aspartate aminotransferase; mitochondrial protein
other names :
Homo sapiens glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) (GOT2), nuclear gene encoding mitochondrial protein, mRNA; Aspartate aminotransferase, mitochondrial; aspartate aminotransferase, mitochondrial; FABP-1; FABPpm; mAspAT; transaminase A; fatty acid-binding protein; kynurenine aminotransferase IV; glutamate oxaloacetate transaminase 2; plasma membrane-associated fatty acid-binding protein; glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2); Fatty acid-binding protein; FABP-1; Glutamate oxaloacetate transaminase 2; Plasma membrane-associated fatty acid-binding protein; FABPpm; Transaminase A
other gene names :
GOT2; GOT2; KAT4; KATIV; mitAAT; mAspAT; FABP-1; FABPpm
uniprot entry name :
AATM_HUMAN
host :
E Coli
sequence :
WTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDN
GKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASA
ELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFF
KFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCG
FDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWK
EIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIE
QGINVCLCQSYAK
purity :
0.95
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.
products references :
[1] "Nucleotide sequence and tissue distribution of the human mitochondrial aspartate aminotransferase mRNA.
ncbi gi num :
73486657
ncbi acc num :
NP_002071.2
ncbi gb acc num :
NM_002080.2
uniprot acc num :
P00505
ncbi mol weight :
54 KD
ncbi pathways :
Alanine And Aspartate Metabolism Pathway 198783!!Alanine, Aspartate And Glutamate Metabolism Pathway 101142!!Alanine, Aspartate And Glutamate Metabolism Pathway 100063!!Amino Acid Synthesis And Interconversion (transamination) Pathway 106173!!Arginine And Proline Metabolism Pathway 82957!!Arginine And Proline Metabolism Pathway 323!!Cysteine And Methionine Metabolism Pathway 104488!!Cysteine And Methionine Metabolism Pathway 103421!!Fat Digestion And Absorption Pathway 194385!!Fat Digestion And Absorption Pathway 194324
ncbi summary :
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids. Ref.6. Catalytic activity: L-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate. Cofactor: Pyridoxal phosphate. Subunit structure: Homodimer. Subcellular location: Mitochondrion matrix. Cell membrane. Note: Exposure to alcohol promotes translocation to the cell membrane. Ref.6. Induction: Up-regulated by long-time exposure to alcohol. Ref.6. Miscellaneous: In eukaryotes there are cytoplasmic, mitochondrial and chloroplastic isozymes. Sequence similarities: Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!