product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Lactadherin protein
catalog :
MBS717276
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717276
products type :
Recombinant Protein
products full name :
Recombinant Human Lactadherin protein
products short name :
Lactadherin
products name syn :
Breast epithelial antigen BA46; HMFG; MFGM; Milk fat globule-EGF factor 8; MFG-E8; SED1
other names :
lactadherin isoform b; Lactadherin; lactadherin; milk fat globule-EGF factor 8 protein; Breast epithelial antigen BA46; HMFG; MFGM; Milk fat globule-EGF factor 8; MFG-E8
products gene name :
MFGE8
other gene names :
MFGE8; MFGE8; BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888; MFG-E8
uniprot entry name :
MFGM_HUMAN
host :
E Coli
sequence positions :
25-334
sequence length :
335
sequence :
DICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAG
NHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWV
PELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGV
VTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHK
EFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLR
FELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLH
LFSWNPSYARLDKQGNFNAWV
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cardiovascular
products description :
Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Contributes to phagocytic roval of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication. 1 Publication
products references :
Cloning and sequence analysis of human breast epithelial antigen BA46 reveals an RGD cell adhesion sequence presented on an epidermal growth factor-like domain.Couto J.R., Taylor M.R., Godwin S.G., Ceriani R.L., Peterson J.A.DNA Cell Biol. 15:281-286(1996)
ncbi gi num :
167830477
ncbi acc num :
NP_001108086.1
ncbi gb acc num :
NM_001114614.2
uniprot acc num :
Q08431
ncbi mol weight :
62.4kD
ncbi pathways :
Amyloid Fiber Formation Pathway (1269169); Integrins In Angiogenesis Pathway (137999); Metabolism Of Proteins Pathway (1268677)
ncbi summary :
This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
uniprot summary :
MFGE8: Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 15q25. Cellular Component: external side of plasma membrane; extracellular matrix; extracellular region; extracellular space; extrinsic to plasma membrane; membrane. Molecular Function: integrin binding; phosphatidylethanolamine binding; phosphatidylserine binding. Biological Process: angiogenesis; cell adhesion; cellular protein metabolic process; phagocytosis, engulfment; phagocytosis, recognition; positive regulation of cell proliferation; response to estrogen stimulus; single fertilization; viral reproduction
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!