catalog number :
MBS717273
products type :
Recombinant Protein
products full name :
Recombinant Human Fructose-bisphosphate aldolase A
products short name :
Fructose-bisphosphate aldolase A
products name syn :
Lung cancer antigen NY-LU-1; Muscle-type aldolase
other names :
fructose-bisphosphate aldolase A isoform 1; Fructose-bisphosphate aldolase A; fructose-bisphosphate aldolase A; aldolase, fructose-bisphosphate A; Lung cancer antigen NY-LU-1; Muscle-type aldolase
products gene name :
ALDOA
other gene names :
ALDOA; ALDOA; ALDA; GSD12; HEL-S-87p; ALDA
uniprot entry name :
ALDOA_HUMAN
sequence positions :
2-364
sequence :
PYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSI
AKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVIL
FHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAG
TNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEH
TPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGD
HDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVT
PGHACTQKFSHEEIAMATVTA
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Metabolism
products description :
Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein.
products references :
Nucleotide sequence of a cDNA clone for human aldolase
a messenger RNA in the liver.Sakakibara M., Mukai T., Hori K.Biochem. Biophys. Res. Commun. 131:413-420(1985)
ncbi acc num :
NP_000025.1
ncbi gb acc num :
NM_000034.3
ncbi pathways :
Biosynthesis Of Amino Acids Pathway (790012); Biosynthesis Of Amino Acids Pathway (795174); Carbon Metabolism Pathway (814926); Carbon Metabolism Pathway (817567); Fructose And Mannose Metabolism Pathway (82930); Fructose And Mannose Metabolism Pathway (291); Gluconeogenesis Pathway (1269961); Gluconeogenesis, Oxaloacetate = Fructose-6P Pathway (413342); Gluconeogenesis, Oxaloacetate = Fructose-6P Pathway (468196); Glucose Metabolism Pathway (1269959)
ncbi summary :
The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10. [provided by RefSeq, Aug 2011]
uniprot summary :
ALDOA: a glycolytic enzyme that catalyzes D-fructose 1,6-bisphosphate - glycerone phosphate + D-glyceraldehyde 3-phosphate. Three forms of aldolase are found in vertebrates - aldolase A in muscle, aldolase B in liver and aldolase C in brain. Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Carbohydrate Metabolism - fructose and mannose; Carbohydrate Metabolism - pentose phosphate pathway; Mitochondrial; Lyase; EC 4.1.2.13. Chromosomal Location of Human Ortholog: 16p11.2. Cellular Component: actin cytoskeleton; cytosol; extracellular region; extracellular space; I band; M band; membrane; nucleus. Molecular Function: actin binding; cytoskeletal protein binding; fructose-bisphosphate aldolase activity; identical protein binding; protein binding; tubulin binding. Biological Process: actin filament organization; ATP biosynthetic process; blood coagulation; carbohydrate metabolic process; fructose 1,6-bisphosphate metabolic process; fructose metabolic process; gluconeogenesis; glucose metabolic process; glycolysis; muscle maintenance; platelet activation; platelet degranulation; protein homotetramerization; regulation of cell shape; striated muscle contraction. Disease: Glycogen Storage Disease Xii