product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Cytochrome c oxidase subunit 5A, mitochondrial
catalog :
MBS717269
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717269
products type :
Recombinant Protein
products full name :
Recombinant human Cytochrome c oxidase subunit 5A, mitochondrial
products short name :
Cytochrome c oxidase subunit 5A, mitochondrial
products name syn :
Recombinant human Cytochrome c oxidase subunit 5A; mitochondrial protein
other names :
Homo sapiens cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein, mRNA; Cytochrome c oxidase subunit 5A, mitochondrial; cytochrome c oxidase subunit 5A, mitochondrial; cytochrome c oxidase polypeptide Va; mitochondrial cytochrome c oxidase subunit Va; cytochrome c oxidase polypeptide, mitochondrial; cytochrome c oxidase subunit Va; Cytochrome c oxidase polypeptide Va
other gene names :
COX5A; COX5A; VA; COX; COX-VA
uniprot entry name :
COX5A_HUMAN
host :
E Coli
sequence :
SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTY
DMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPH
KEIYPYVIQELRPTLNELGISTPEELGLDKV
purity :
0.95
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: GST-tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
products references :
[1] "Subunit Va of human and bovine cytochrome c oxidase is highly conserved.
ncbi gi num :
190885498
ncbi acc num :
NP_004246.2
ncbi gb acc num :
NM_004255.3
uniprot acc num :
P20674
ncbi mol weight :
37 KD
ncbi pathways :
Alzheimer's Disease Pathway 83097!!Alzheimer's Disease Pathway 509!!Arachidonate Epoxygenase / Epoxide Hydrolase Pathway 198838!!Cardiac Muscle Contraction Pathway 93344!!Cardiac Muscle Contraction Pathway 93992!!Cytochrome C Oxidase Pathway 413434!!Cytochrome C Oxidase Pathway 468345!!Electron Transport Chain Pathway 198860!!Huntington's Disease Pathway 83100!!Huntington's Disease Pathway 512
ncbi summary :
Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer of proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Va of the human mitochondrial respiratory chain enzyme. A pseudogene COX5AP1 has been found in chromosome 14q22. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Subcellular location: Mitochondrion inner membrane. Sequence similarities: Belongs to the cytochrome c oxidase subunit 5A family.
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!