product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human High mobility group protein B1
catalog :
MBS717248
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717248
products type :
Recombinant Protein
products full name :
Recombinant human High mobility group protein B1
products short name :
High mobility group protein B1
products name syn :
Recombinant human High mobility group protein B1 protein
other names :
Homo sapiens high mobility group box 1 (HMGB1), mRNA; High mobility group protein B1; high mobility group protein B1; HMG-1; Amphoterin; high-mobility group box 1; high mobility group protein 1; Sulfoglucuronyl carbohydrate binding protein; high-mobility group (nonhistone chromosomal) protein 1; high mobility group box 1; High mobility group protein 1
other gene names :
HMGB1; HMGB1; HMG1; HMG3; SBP-1; HMG1; HMG-1
uniprot entry name :
HMGB1_HUMAN
host :
E Coli
sequence :
KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCS
ERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGET
KKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGD
VAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYR
AKGKPDAAKKGVVKAE
purity :
0.95
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: GST-tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells
products references :
[1] "A human placental cDNA clone that encodes nonhistone chromosomal protein HMG-1.
ncbi gi num :
118918424
ncbi acc num :
NP_002119.1
ncbi gb acc num :
NM_002128.4
uniprot acc num :
P09429
ncbi mol weight :
46 KD
ncbi pathways :
Activated TLR4 Signalling Pathway 106400!!Activation Of DNA Fragmentation Factor Pathway 105683!!Advanced Glycosylation Endproduct Receptor Signaling Pathway 187092!!Androgen Receptor Signaling Pathway 198806!!Apoptosis Pathway 105648!!Apoptosis Induced DNA Fragmentation Pathway 105682!!Apoptotic Execution Phase Pathway 105677!!Base Excision Repair Pathway 83043!!Base Excision Repair Pathway 451!!Cytosolic Sensors Of Pathogen-associated DNA Pathway 576255
uniprot summary :
Function: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells . By similarity. Subunit structure: Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2 . By similarity. Subcellular location: Nucleus. Chromosome. Sequence similarities: Belongs to the HMGB family.Contains 2 HMG box DNA-binding domains.
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!