product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
catalog :
MBS717223
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS717223
products type :
Recombinant Protein
products full name :
Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
products short name :
Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
other names :
serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; protein phosphatase 2 catalytic subunit beta
products gene name :
PPP2CB
other gene names :
PPP2CB; PPP2CB; PP2CB; PP2Abeta; PP2A-beta
uniprot entry name :
PP2AB_HUMAN
host :
E Coli
sequence positions :
1-309
sequence length :
309
sequence :
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEIL
TKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDT
NYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGN
HESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLT
ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPM
CDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGL
TLVSRAHQLVMEGYNWCHDRN
TKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDT
NYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGN
HESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLT
ALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPM
CDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGL
TLVSRAHQLVMEGYNWCHDRN
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Signal Transduction
products description :
PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.
products references :
The nucleotide sequence of the cDNA encoding the human lung protein phosphatase 2A beta catalytic subunit.Hemmings B.A., Wernet W., Mayer R., Maurer F., Hofsteenge J., Stone S.R.Nucleic Acids Res. 16:11366-11366(1988)
ncbi gi num :
57222565
ncbi acc num :
NP_001009552.1
ncbi gb acc num :
NM_001009552.1
uniprot acc num :
P62714
ncbi mol weight :
63kD
ncbi pathways :
AMER1 Mutants Destabilize The Destruction Complex Pathway (1268913); AMPK Signaling Pathway (989139); AMPK Signaling Pathway (992181); APC Truncation Mutants Have Impaired AXIN Binding Pathway (1268909); ARMS-mediated Activation Pathway (1269471); AXIN Missense Mutants Destabilize The Destruction Complex Pathway (1268912); AXIN Mutants Destabilize The Destruction Complex, Activating WNT Signaling Pathway (1268910); Activated TLR4 Signalling Pathway (1269236); Adaptive Immune System Pathway (1269171); Adrenergic Signaling In Cardiomyocytes Pathway (908257)
ncbi summary :
This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit. [provided by RefSeq, Mar 2010]
uniprot summary :
PPP2CB: one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. Protein type: EC 3.1.3.16; Protein phosphatase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 8p12. Cellular Component: chromosome, pericentric region; cytosol; nucleus; protein phosphatase type 2A complex; spindle pole. Molecular Function: metal ion binding; protein binding; protein C-terminus binding; protein serine/threonine phosphatase activity. Biological Process: apoptotic mitochondrial changes; fibroblast growth factor receptor signaling pathway; negative regulation of Ras protein signal transduction; proteasomal ubiquitin-dependent protein catabolic process; protein amino acid dephosphorylation; regulation of gene expression; response to antibiotic; response to hydrogen peroxide
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!