Recombinant human C-C motif chemokine 5 protein | MyBioSource MBS717211 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant human C-C motif chemokine 5 protein

catalog :

MBS717211

quantity :

0.01 mg

price :

135 USD

product information

catalog number :

MBS717211

products type :

Recombinant Protein

products full name :

Recombinant human C-C motif chemokine 5 protein

products short name :

C-C motif chemokine 5

products name syn :

Storage Buffer PBS pH 7.4, 50% glycerol

other names :

Homo sapiens chemokine (C-C motif) ligand 5 (CCL5), mRNA; C-C motif chemokine 5; C-C motif chemokine 5; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; chemokine (C-C motif) ligand 5; EoCP; Eosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5; T cell-specific protein P228; TCP228; T-cell-specific protein RANTES

products gene name syn :

Recombinant C-C motif chemokine 5 protein

other gene names :

CCL5; CCL5; SISd; SCYA5; RANTES; TCP228; D17S136E; D17S136E; SCYA5; TCP228

uniprot entry name :

CCL5_HUMAN

host :

E Coli

sequence :

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAV
VFVTRKNRQVCANPEKKWVREYINSLEMS

purity :

90%

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

tested application :

SDS-PAGE, ELISA (EIA)

other info1 :

Tag Information: GST tagged

other info2 :

Storage Buffer: PBS pH 7.4, 50% glycerol

products description :

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.

ncbi gi num :

22538813

ncbi acc num :

NP_002976.2

ncbi gb acc num :

NM_002985.2

uniprot acc num :

P13501

ncbi mol weight :

34 KD

ncbi pathways :

Chagas Disease (American Trypanosomiasis) Pathway 147809!!Chagas Disease (American Trypanosomiasis) Pathway 147795!!Chemokine Receptors Bind Chemokines Pathway 106359!!Chemokine Signaling Pathway 99051!!Chemokine Signaling Pathway 96864!!Class A/1 (Rhodopsin-like Receptors) Pathway 106357!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Cytosolic DNA-sensing Pathway 125137!!Cytosolic DNA-sensing Pathway 124833

ncbi summary :

This gene is one of several CC cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor CCR5 and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. [provided by RefSeq, Jul 2008]

uniprot summary :

Function: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. Ref.3 Ref.8 Ref.10 Ref.11 Ref.12. Subcellular location: Secreted. Tissue specificity: T-cell and macrophage specific. Induction: By mitogens. Post-translational modification: N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in Ref.8. They are assigned by similarity. Polymorphism: The variant Phe-24 is an antagonist of the chemokine receptors CCR1 and CCR3. Sequence similarities: Belongs to the intercrine beta (chemokine CC) family. Mass spectrometry: Molecular mass is 7515 1 Da from positions 27 - 91. Determined by SELDI. Ref.12Molecular mass is 7862.8 1.1 Da from positions 24 - 91. Determined by ESI. Ref.8Molecular mass is 8355 10 Da from positions 24 - 91. Determined by ESI. O-glycosylated. Ref.8

size :

0.01 mg

price :

135 USD