This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
protein
product name :
Recombinant human C-C motif chemokine 5 protein
catalog :
MBS717211
quantity :
0.01 mg
price :
135 USD
product information
catalog number :
MBS717211
products type :
Recombinant Protein
products full name :
Recombinant human C-C motif chemokine 5 protein
products short name :
C-C motif chemokine 5
products name syn :
Storage Buffer PBS pH 7.4, 50% glycerol
other names :
Homo sapiens chemokine (C-C motif) ligand 5 (CCL5), mRNA; C-C motif chemokine 5; C-C motif chemokine 5; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; chemokine (C-C motif) ligand 5; EoCP; Eosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5; T cell-specific protein P228; TCP228; T-cell-specific protein RANTES
products gene name syn :
Recombinant C-C motif chemokine 5 protein
other gene names :
CCL5; CCL5; SISd; SCYA5; RANTES; TCP228; D17S136E; D17S136E; SCYA5; TCP228
uniprot entry name :
CCL5_HUMAN
host :
E Coli
sequence :
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAV
VFVTRKNRQVCANPEKKWVREYINSLEMS
purity :
90%
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
tested application :
SDS-PAGE, ELISA (EIA)
other info1 :
Tag Information: GST tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.
ncbi gi num :
22538813
ncbi acc num :
NP_002976.2
ncbi gb acc num :
NM_002985.2
uniprot acc num :
P13501
ncbi mol weight :
34 KD
ncbi pathways :
Chagas Disease (American Trypanosomiasis) Pathway 147809!!Chagas Disease (American Trypanosomiasis) Pathway 147795!!Chemokine Receptors Bind Chemokines Pathway 106359!!Chemokine Signaling Pathway 99051!!Chemokine Signaling Pathway 96864!!Class A/1 (Rhodopsin-like Receptors) Pathway 106357!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Cytosolic DNA-sensing Pathway 125137!!Cytosolic DNA-sensing Pathway 124833
ncbi summary :
This gene is one of several CC cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor CCR5 and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. Ref.3 Ref.8 Ref.10 Ref.11 Ref.12. Subcellular location: Secreted. Tissue specificity: T-cell and macrophage specific. Induction: By mitogens. Post-translational modification: N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in Ref.8. They are assigned by similarity. Polymorphism: The variant Phe-24 is an antagonist of the chemokine receptors CCR1 and CCR3. Sequence similarities: Belongs to the intercrine beta (chemokine CC) family. Mass spectrometry: Molecular mass is 7515 1 Da from positions 27 - 91. Determined by SELDI. Ref.12Molecular mass is 7862.8 1.1 Da from positions 24 - 91. Determined by ESI. Ref.8Molecular mass is 8355 10 Da from positions 24 - 91. Determined by ESI. O-glycosylated. Ref.8
size :
0.01 mg
price :
135 USD
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!