Recombinant Human Cytochrome b-c1 complex subunit Rieske, mitochondrial protein | MyBioSource MBS717210 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Cytochrome b-c1 complex subunit Rieske, mitochondrial protein

catalog :

MBS717210

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717210

products type :

Recombinant Protein

products full name :

Recombinant Human Cytochrome b-c1 complex subunit Rieske, mitochondrial protein

products short name :

Cytochrome b-c1 complex subunit Rieske

products name syn :

Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP; Ubiquinol-cytochrome c reductase iron-sulfur subunit

other names :

cytochrome b-c1 complex subunit Rieske, mitochondrial; Cytochrome b-c1 complex subunit Rieske, mitochondrial; cytochrome b-c1 complex subunit Rieske, mitochondrial; ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1; Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP

products gene name :

UQCRFS1

other gene names :

UQCRFS1; UQCRFS1; RIP1; RIS1; RISP; UQCR5; RISP

uniprot entry name :

UCRI_HUMAN

host :

E Coli

sequence positions :

79-274

sequence length :

274

sequence :

SHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLV
TGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKL
SDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQL
RDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGY
YCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
G

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transport

products description :

Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochical potential coupled to ATP synthesis. The transit peptide of the Rieske protein ses to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.

products references :

The primary structure of human Rieske iron-sulfur protein of mitochondrial cytochrome bc1 complex deduced from cDNA analysis.Nishikimi M., Hosokawa Y., Toda H., Suzuki H., Ozawa T.Biochem. Int. 20:155-160(1990) Structure, sequence and location of the UQCRFS1 gene for the human Rieske Fe-S protein.Pennacchio L., Bergmann A., Fukushima A., Salemi A., Okubo K., Lennon G.Gene 155:207-211(1995) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004) Renal cell carcinoma and normal kidney protein expression.Sarto C., Marocchi A., Sanchez J.-C., Giannone B., Frutiger S., Golaz O., Wilkins M.R., Doro G., Cappellano F., Hughes G.J., Hochstrasser D.F., Mocarelli P.Electrophoresis 18:599-604(1997) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

ncbi gi num :

163644321

ncbi acc num :

NP_005994.2

ncbi gb acc num :

NM_006003.2

uniprot acc num :

P47985

ncbi mol weight :

49kD

ncbi pathways :

Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Cardiac Muscle Contraction Pathway (93344); Cardiac Muscle Contraction Pathway (93992); Cytochrome Bc1 Complex Pathway (413442); Cytochrome Bc1 Complex Pathway (546500); Cytochrome Bc1 Complex Respiratory Unit Pathway (413411); Cytochrome Bc1 Complex Respiratory Unit Pathway (468344); Electron Transport Chain Pathway (198860); Huntington's Disease Pathway (83100)

uniprot summary :

UQCRFS1: Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis. Protein type: EC 1.10.2.2; Mitochondrial; Oxidoreductase; Energy Metabolism - oxidative phosphorylation. Chromosomal Location of Human Ortholog: 19q12. Cellular Component: mitochondrial inner membrane; mitochondrial respiratory chain complex III; mitochondrion; myelin sheath. Molecular Function: 2 iron, 2 sulfur cluster binding; metal ion binding; protein complex binding; ubiquinol-cytochrome-c reductase activity. Biological Process: cellular metabolic process; response to antibiotic; response to drug; response to hormone stimulus

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

410

size3 :

0.5 mg (E-Coli)

price3 :

665

size4 :

1 mg (E-Coli)

price4 :

1050

more info or order :

MyBioSource product webpage