Recombinant human Replication protein A 32 kDa subunit | MyBioSource MBS717206 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant human Replication protein A 32 kDa subunit

catalog :

MBS717206

quantity :

0.05 mg

price :

195 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717206

products type :

Recombinant Protein

products full name :

Recombinant human Replication protein A 32 kDa subunit

products short name :

Replication protein A 32 kDa subunit

products name syn :

Recombinant human Replication protein A 32 kDa subunit protein

other names :

Homo sapiens replication protein A2, 32kDa (RPA2), mRNA; Replication protein A 32 kDa subunit; replication protein A 32 kDa subunit; RP-A p32; RP-A p34; RF-A protein 2; replication factor A protein 2; replication protein A 34 kDa subunit; replication protein A2, 32kDa; Replication factor A protein 2; RF-A protein 2; Replication protein A 34 kDa subunit

other gene names :

RPA2; RPA2; REPA2; RPA32; REPA2; RPA32; RPA34; RP-A p32; RF-A protein 2; RP-A p34

uniprot entry name :

RFA2_HUMAN

host :

E Coli

sequence :

MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKS
RARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVG
IIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSEN
TVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFT
THILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFG
GNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQL
KHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKST

purity :

0.9

storage stability :

Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

other info1 :

Tag Information: GST tagged

other info2 :

Storage Buffer: PBS pH 7.4, 50% glycerol

products description :

Required for DNA recombination, repair and replication. The activity of RP-A is mediated by single-stranded DNA binding and protein interactions. Required for the efficient recruitment of the DNA double-strand break repair factor RAD51 to chromatin in response to DNA damage. Ref.9 Ref.13 Ref.14 Ref.15

products references :

[1] "The primary structure of the 32-kDa subunit of human replication protein A.

ncbi gi num :

34147622

ncbi acc num :

NP_002937.1

ncbi gb acc num :

NM_002946.3

uniprot acc num :

P15927

ncbi mol weight :

56 KD

ncbi pathways :

Activation Of ATR In Response To Replication Stress Pathway 105754!!Activation Of The Pre-replicative Complex Pathway 105777!!Assembly Of The RAD51-ssDNA Nucleoprotein Complex Pathway 105873!!Cell Cycle Pathway 530733!!Cell Cycle Checkpoints Pathway 105739!!Cell Cycle, Mitotic Pathway 105765!!Chromosome Maintenance Pathway 161048!!DNA Repair Pathway 105837!!DNA Replication Pathway 198771!!DNA Replication Pathway 105897

uniprot summary :

Function: Required for DNA recombination, repair and replication. The activity of RP-A is mediated by single-stranded DNA binding and protein interactions. Required for the efficient recruitment of the DNA double-strand break repair factor RAD51 to chromatin in response to DNA damage. Ref.9 Ref.13 Ref.14 Ref.15Functions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange. Ref.9 Ref.13 Ref.14 Ref.15. Subunit structure: Heterotrimer of 70, 32 and 14 kDa chains (canonical replication protein A complex). Component of the alternative replication protein A complex (aRPA) composed of RPA1, RPA3 and RPA4. The DNA-binding activity may reside exclusively on the 70 kDa subunit. Binds to SERTAD3/RBT1. Interacts with TIPIN. Directly interacts with PPP4R2, but not with SMEK2; this interaction is DNA damage-dependent and leads RPA2 dephosphorylation by PPP4C recruitment. Interacts with RAD51, preferentially when hyperphosphorylated. Directly interacts with RFWD3. Ref.7 Ref.10 Ref.11 Ref.15 Ref.17 Ref.18. Subcellular location: Nucleus. Nucleus PML body. Note: Also present in PML nuclear bodies. Redistributes to discrete nuclear foci upon DNA damage. Ref.8 Ref.15 Ref.17 Ref.18. Post-translational modification: Phosphorylated in a cell-cycle-dependent manner (from the S phase until mitosis). In response to DNA damage, recruited to DNA-repair nuclear foci, as an hypophosphorylated form. The necessary dephosphorylation step is catalyzed by PP4. Subsequent hyperphosphorylation, catalyzed by ATR, is required for RAD51 recruitment to chromatin and efficient DNA repair. Can be phosphorylated in vitro by PRKDC/DNA-PK in the presence of Ku and DNA, and by CDK1. Phosphorylation at Thr-21 depends upon RFWD3 presence. Ref.6 Ref.8 Ref.18

size :

0.05 mg

price :

195 USD

more info or order :

MyBioSource product webpage