Recombinant Human Myc proto-oncogene protein | MyBioSource MBS717188 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Myc proto-oncogene protein

catalog :

MBS717188

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717188

products type :

Recombinant Protein

products full name :

Recombinant Human Myc proto-oncogene protein

products short name :

Myc proto-oncogene protein

products name syn :

Class E basic helix-loop-helix protein 39; bHLHe39; Proto-oncogene c-Myc; Transcription factor p64

other names :

myc proto-oncogene protein; Myc proto-oncogene protein; myc proto-oncogene protein; v-myc avian myelocytomatosis viral oncogene homolog; Class E basic helix-loop-helix protein 39; bHLHe39; Proto-oncogene c-Myc; Transcription factor p64

products gene name :

MYC

other gene names :

MYC; MYC; MRTL; MYCC; c-Myc; bHLHe39; BHLHE39; bHLHe39

uniprot entry name :

MYC_HUMAN

host :

E Coli

sequence positions :

1-439

sequence length :

454

sequence :

MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSE
LQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVT
PFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFIC
DPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAAR
KDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVF
PYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGS
PEPLVLHEETPPTTSSDSEEE

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transcription

products description :

Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes.

products references :

The human c-myc oncogene structural consequences of translocation into the IgH locus in Burkitt lymphoma.Battey J., Moulding C., Taub R., Murphy W., Stewart T., Potter H., Lenoir G., Leder P.Cell 34:779-787(1983)

ncbi gi num :

71774083

ncbi acc num :

NP_002458.2

ncbi gb acc num :

NM_002467.4

uniprot acc num :

P01106

ncbi mol weight :

76.2kD

ncbi pathways :

Acute Myeloid Leukemia Pathway (83117); Acute Myeloid Leukemia Pathway (529); Apoptosis Pathway (198797); Binding Of TCF/LEF:CTNNB1 To Target Gene Promoters Pathway (1269603); Bladder Cancer Pathway (83115); Bladder Cancer Pathway (527); C-MYB Transcription Factor Network Pathway (138073); C-MYC Pathway (169344); CD40/CD40L Signaling Pathway (138061); Cell Cycle Pathway (1269741)

ncbi summary :

The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. [provided by RefSeq, Jul 2008]

uniprot summary :

Myc: a proto-oncogenic transcription factor that plays a role in cell proliferation, apoptosis and in the development of human tumors. Seems to activate the transcription of growth-related genes. Protein type: Transcription factor; Oncoprotein; Nucleolus; DNA-binding. Chromosomal Location of Human Ortholog: 8q24.21. Cellular Component: cytosol; nucleolus; nucleoplasm; nucleus; protein complex. Molecular Function: DNA binding; protein binding; protein complex binding; protein dimerization activity; transcription factor activity; transcription factor binding. Biological Process: cell cycle arrest; cellular iron ion homeostasis; chromatin remodeling; chromosome organization and biogenesis; energy reserve metabolic process; gene expression; MAPKKK cascade; negative regulation of apoptosis; negative regulation of cell division; negative regulation of fibroblast proliferation; negative regulation of monocyte differentiation; negative regulation of stress-activated MAPK cascade; negative regulation of transcription from RNA polymerase II promoter; Notch signaling pathway; oxygen transport; positive regulation of caspase activity; positive regulation of cell proliferation; positive regulation of epithelial cell proliferation; positive regulation of fibroblast proliferation; positive regulation of mesenchymal cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of gene expression; regulation of telomere maintenance; response to DNA damage stimulus; response to drug; response to gamma radiation; transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; ureteric bud branching; Wnt receptor signaling pathway through beta-catenin. Disease: Burkitt Lymphoma

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

410

size3 :

0.5 mg (E-Coli)

price3 :

665

size4 :

1 mg (E-Coli)

price4 :

1050

more info or order :

MyBioSource product webpage