protein

Recombinant human Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

MBS717181

0.05 mg

195 USD

Recombinant Protein

Recombinant human Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

Recombinant human Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 protein

Homo sapiens defender against cell death 1 (DAD1), mRNA; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; DAD-1; oligosaccharyltransferase 2 homolog; oligosaccharyl transferase subunit DAD1; defender against cell death 1; Defender against cell death 1

DAD1; DAD1; OST2; Oligosaccharyl transferase subunit DAD1; DAD-1

DAD1_HUMAN

E Coli

SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGAL
QFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINP
QNKADFQGISPERAFADFLFASTILHLVVMNFVG

0.95

Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

Tag Information: GST-tagged

Storage Buffer: PBS pH 7.4, 50% glycerol

Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis

[1] "Molecular cloning of a human cDNA encoding a novel protein, DAD1, whose defect causes apoptotic cell death in hamster BHK21 cells.

168693661

NP_001335.1

NM_001344.2

P61803

39 KD

Asparagine N-linked Glycosylation Pathway 161013!!Metabolism Of Proteins Pathway 106230!!N-Glycan Biosynthesis Pathway 82975!!N-Glycan Biosynthesis Pathway 345!!Oligosaccharyltransferase Pathway 413373!!Post-translational Protein Modification Pathway 161012!!Protein Processing In Endoplasmic Reticulum Pathway 167325!!Protein Processing In Endoplasmic Reticulum Pathway 167190

DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. [provided by RefSeq, Jul 2008]

Function: Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis . By similarity. Catalytic activity: Dolichyl diphosphooligosaccharide + protein L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-glycosyl linkage to protein L-asparagine. Subunit structure: Component of the oligosaccharyltransferase (OST) complex. OST seems to exist in different forms which contain at least RPN1, RPN2, OST48, DAD1, OSTC, KRTCAP2 and either STT3A or STT3B. OST can form stable complexes with the Sec61 complex or with both the Sec61 and TRAP complexes . By similarity. Subcellular location: Membrane; Multi-pass membrane protein . Potential. Sequence similarities: Belongs to the DAD/OST2 family.

0.05 mg

195 USD