protein

Recombinant human AP-2 complex subunit sigma protein

MBS717158

0.05 mg

195 USD

Recombinant Protein

Recombinant human AP-2 complex subunit sigma protein

AP-2 complex subunit sigma protein

Recombinant human AP-2 complex subunit sigma protein

Homo sapiens adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17, mRNA; AP-2 complex subunit sigma; AP-2 complex subunit sigma; sigma2-adaptin; HA2 17 kDa subunit; clathrin coat assembly protein AP17; clathrin coat-associated protein AP17; clathrin assembly protein 2 small chain; adaptor protein complex AP-2 subunit sigma; plasma membrane adaptor AP-2 17 kDa protein; adapter-related protein complex 2 sigma subunit; clathrin-associated/assembly/adaptor protein, small 2 (17kD); adaptor-related protein complex 2, sigma 1 subunit; Adapter-related protein complex 2 sigma subunit; Adaptor protein complex AP-2 subunit sigma; Clathrin assembly protein 2 small chain; Clathrin coat assembly protein AP17; Clathrin coat-associated protein AP17; HA2 17 kDa subunit; Plasma membrane adaptor AP-2 17 kDa protein; Sigma2-adaptin

AP2S1; AP2S1; AP17; CLAPS2; AP17-DELTA; AP17; CLAPS2

AP2S1_HUMAN

E Coli

MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVV
TVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNL
AYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEM
FLAGEIRETSQTKVLKQLLMLQSLE

0.9

Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

Tag Information: GST tagged

Storage Buffer: PBS pH 7.4, 50% glycerol

Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein Transport via Transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 alpha and AP-2 sigma subunits are thought to contribute to the recognition of the [ED]-X-X-X-L-[LI] motif.

[1] "Human CLAPS2 encoding AP17, a small chain of the clathrin-associated protein complex: cDNA cloning and chromosomal assignment to 19q13.2-->q13.3.

70906429

NP_004060.2

NM_004069.3

P53680

43 KD

Adaptive Immune System Pathway 366160!!Axon Guidance Pathway 105688!!Developmental Biology Pathway 477129!!Disease Pathway 530764!!EGFR Downregulation Pathway 106342!!Endocrine And Other Factor-regulated Calcium Reabsorption Pathway 213307!!Endocrine And Other Factor-regulated Calcium Reabsorption Pathway 213276!!Endocytosis Pathway 102279!!Endocytosis Pathway 102181!!Glutamate Binding, Activation Of AMPA Receptors And Synaptic Plasticity Pathway 106536

One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing has been observed in this gene and results in two known transcripts. [provided by RefSeq, Jul 2008]

Function: Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein Transport via Transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 alpha and AP-2 sigma subunits are thought to contribute to the recognition of the [ED]-X-X-X-L-[LI] motif . By similarity. Ref.6 Ref.7 Ref.8. Subunit structure: Adaptor protein complex 2 (AP-2) is an heterotetramer composed of two large adaptins (alpha-type subunit AP2A1 or AP2A2 and beta-type subunit AP2B1), a medium adaptin (mu-type subunit AP2M1) and a small adaptin (sigma-type subunit AP2S1). Subcellular location: Cell membrane. Membrane coated pit; Peripheral membrane protein; Cytoplasmic side. Note: AP-2 appears to be excluded from internalizing CCVs and to disengage from sites of endocytosis seconds before internalization of the nascent CCV . By similarity. Sequence similarities: Belongs to the adaptor complexes small subunit family.

0.05 mg

195 USD