product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2)
catalog :
MBS717155
quantity :
0.01 mg (E-Coli)
price :
160 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717155
products type :
Recombinant Protein
products full name :
Recombinant Human Eukaryotic initiation factor 4A-II (EIF4A2)
products short name :
[Eukaryotic initiation factor 4A-II (EIF4A2)]
other names :
[eukaryotic initiation factor 4A-II; Eukaryotic initiation factor 4A-II; eukaryotic initiation factor 4A-II; eukaryotic translation initiation factor 4A2; ATP-dependent RNA helicase eIF4A-2]
products gene name :
[EIF4A2]
products gene name syn :
[EIF4A2]
other gene names :
[EIF4A2; EIF4A2; DDX2B; EIF4A; EIF4F; BM-010; eIF4A-II; eIF-4A-II; DDX2B; EIF4F; eIF-4A-II; eIF4A-II]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-407. Full Length]
sequence :
MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMN
LKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQ
SGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQI
QKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIV
VGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKD
QIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIR
ILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTI
TQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMDQKER
DVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLP
TNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIET
FYNTTVEEMPMNVADLI
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Human
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
ncbi gi num :
83700235
ncbi acc num :
NP_001958.2
ncbi gb acc num :
NM_001967.3
uniprot acc num :
Q14240
ncbi mol weight :
46,489 Da
ncbi pathways :
Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway (1268683); Antiviral Mechanism By IFN-stimulated Genes Pathway (1269316); Cap-dependent Translation Initiation Pathway (1268680); Cytokine Signaling In Immune System Pathway (1269310); Deadenylation Of MRNA Pathway (1269713); Deadenylation-dependent MRNA Decay Pathway (1269712); Eukaryotic Translation Initiation Pathway (1268679); GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway (1268686); Gene Expression Pathway (1269649); ISG15 Antiviral Mechanism Pathway (1269317)
uniprot summary :
ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
size1 :
0.01 mg (E-Coli)
price1 :
160 USD
size2 :
0.05 mg (E-Coli)
price2 :
200
size3 :
0.1 mg (E-Coli)
price3 :
295
size4 :
0.2 mg (E-Coli)
price4 :
480
size5 :
0.5 mg (E-Coli)
price5 :
790
size6 :
1 mg (E-Coli)
price6 :
1215
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!