Recombinant Mouse Actin, cytoplasmic 1 protein | MyBioSource MBS717154 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Actin, cytoplasmic 1 protein

catalog :

MBS717154

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717154

products type :

Recombinant Protein

products full name :

Recombinant Mouse Actin, cytoplasmic 1 protein

products short name :

Actin, cytoplasmic 1 protein

products name syn :

Beta-actin

other names :

actin, cytoplasmic 1; Actin, cytoplasmic 1; actin, cytoplasmic 1; actin, beta; Beta-actin

products gene name :

ACTB

other gene names :

Actb; Actb; Actx; beta-actin; E430023M04Rik

uniprot entry name :

ACTB_MOUSE

host :

E Coli

sequence positions :

11-375

sequence length :

375

sequence :

DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHH
TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF
NTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIY
EGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE
REIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPD
GQVITIGNERFRCPEALFQPS

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

products references :

Nucleotide sequence of a full-length cDNA for mouse cytoskeletal beta-actin mRNA.Tokunaga K., Taniguchi H., Yoda K., Shimizu M., Sakiyama S.Nucleic Acids Res. 14:2829-2829(1986) Actin amino-acid sequences. Comparison of actins from calf thymus, bovine brain, and SV40-transformed mouse 3T3 cells with rabbit skeletal muscle actin.Vandekerckhove J., Weber K.Eur. J. Biochem. 90:451-462(1978) Lubec G., Klug S., Kang S.U., Sunyer B., Chen W.-Q.Submitted (JAN-2009) to UniProtKB Comparison of three actin-coding sequences in the mouse; evolutionary relationships between the actin genes of warm-blooded vertebrates.Alonso S., Minty A., Bourlet Y., Buckingham M.J. Mol. Evol. 23:11-22(1986) Vilbois F.Submitted (OCT-1998) to UniProtKB Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.Giannakopoulos N.V., Luo J.K., Papov V., Zou W., Lenschow D.J., Jacobs B.S., Borden E.C., Li J., Virgin H.W., Zhang D.E.Biochem. Biophys. Res. Commun. 336:496-506(2005) MsrB1 and MICALs regulate actin assembly and macrophage function via reversible stereoselective methionine oxidation.Lee B.C., Peterfi Z., Hoffmann F.W., Moore R.E., Kaya A., Avanesov A., Tarrago L., Zhou Y., Weerapana E., Fomenko D.E., Hoffmann P.R., Gladyshev V.N.Mol. Cell 51:397-404(2013)

ncbi gi num :

6671509

ncbi acc num :

NP_031419.1

ncbi gb acc num :

NM_007393.5

uniprot acc num :

P60710

ncbi mol weight :

68.1kD

ncbi pathways :

Adherens Junction Pathway (83267); Adherens Junction Pathway (481); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (117303); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (116129); Axon Guidance Pathway (1323598); B-WICH Complex Positively Regulates RRNA Expression Pathway (1323898); Bacterial Invasion Of Epithelial Cells Pathway (149817); Bacterial Invasion Of Epithelial Cells Pathway (148661); DNA Damage Recognition In GG-NER Pathway (1324089); DNA Repair Pathway (1324048)

ncbi summary :

This gene encodes a member of the actin family of proteins. Actins are highly conserved proteins that are among the most abundant proteins in eukaryotic cells and are involved in cell motility, structure, and integrity. Localization, stability, and translation of the transcribed mRNA are regulated through the binding of multiple factors to its 3' UTR sequence. Homozygous knockout mice for this gene exhibit embryonic lethality. Numerous pseudogenes of this gene have been identified in the mouse genome. [provided by RefSeq, Sep 2015]

uniprot summary :

ACTB: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others. Identified in a mRNP granule complex, at least composed of ACTB, ACTN4, DHX9, ERG, HNRNPA1, HNRNPA2B1, HNRNPAB, HNRNPD, HNRNPL, HNRNPR, HNRNPU, HSPA1, HSPA8, IGF2BP1, ILF2, ILF3, NCBP1, NCL, PABPC1, PABPC4, PABPN1, RPLP0, RPS3, RPS3A, RPS4X, RPS8, RPS9, SYNCRIP, TROVE2, YBX1 and untranslated mRNAs. Component of the BAF complex, which includes at least actin (ACTB), ARID1A, ARID1B/BAF250, SMARCA2, SMARCA4/BRG1, ACTL6A/BAF53, ACTL6B/BAF53B, SMARCE1/BAF57 SMARCC1/BAF155, SMARCC2/BAF170, SMARCB1/SNF5/INI1, and one or more of SMARCD1/BAF60A, SMARCD2/BAF60B, or SMARCD3/BAF60C. In muscle cells, the BAF complex also contains DPF3. Found in a complex with XPO6, Ran, ACTB and PFN1. Component of the MLL5-L complex, at least composed of MLL5, STK38, PPP1CA, PPP1CB, PPP1CC, HCFC1, ACTB and OGT. Interacts with XPO6 and EMD. Interacts with ERBB2. Interacts with GCET2. Belongs to the actin family. Protein type: Cytoskeletal; Motility/polarity/chemotaxis. Cellular Component: axon; cortical cytoskeleton; cytoplasm; cytoskeleton; cytosol; extracellular space; focal adhesion; membrane; myelin sheath; NuA4 histone acetyltransferase complex; nuclear chromatin; postsynaptic density; protein complex; ribonucleoprotein complex. Molecular Function: ATP binding; identical protein binding; kinesin binding; nitric-oxide synthase binding; nucleosomal DNA binding; nucleotide binding; protein binding; protein kinase binding; Tat protein binding. Biological Process: ATP-dependent chromatin remodeling; axonogenesis

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

410

size3 :

0.5 mg (E-Coli)

price3 :

665

size4 :

1 mg (E-Coli)

price4 :

1050

more info or order :

MyBioSource product webpage