product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Heat shock protein 75 kDa, mitochondrial
catalog :
MBS717144
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717144
products type :
Recombinant Protein
products full name :
Recombinant human Heat shock protein 75 kDa, mitochondrial
products short name :
Heat shock protein 75 kDa, mitochondrial
products name syn :
Recombinant human Heat shock protein 75 kDa; mitochondrial protein
other names :
Homo sapiens TNF receptor-associated protein 1 (TRAP1), mRNA; Heat shock protein 75 kDa, mitochondrial; heat shock protein 75 kDa, mitochondrial; HSP 75; TRAP-1; TNFR-associated protein 1; tumor necrosis factor type 1 receptor associated protein; tumor necrosis factor type 1 receptor-associated protein; TNF receptor-associated protein 1; TNFR-associated protein 1; Tumor necrosis factor type 1 receptor-associated protein
other gene names :
TRAP1; TRAP1; HSP75; HSP90L; HSP75; HSP 75; TRAP-1
uniprot entry name :
TRAP1_HUMAN
host :
E Coli
sequence :
STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLL
DIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQA
LPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIA
RSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRV
EVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKII
IHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMN
TLQAIWMMDPKDVRE
purity :
0.95
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: GST-tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Chaperone that expresses an ATPase activity.
products references :
[1] "A direct interaction between EXT proteins and glycosyltransferases is defective in hereditary multiple exostoses.
ncbi gi num :
155722982
ncbi acc num :
NP_057376.2
ncbi gb acc num :
NM_016292.2
uniprot acc num :
Q12931
ncbi mol weight :
54 KD
ncbi pathways :
TGF-beta Receptor Signaling Pathway 198774
ncbi summary :
HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. TRAP1 is a mitochondrial HSP90 protein. Other HSP90 proteins are found in cytosol (see HSP90AA1; MIM 140571) and endoplasmic reticulum (HSP90B1; MIM 191175) (Chen et al., 2005 [PubMed 16269234]).[supplied by OMIM, Aug 2008]
uniprot summary :
Function: Chaperone that expresses an ATPase activity. Subunit structure: Binds to the intracellular domain of tumor necrosis factor type 1 receptor. Binds to RB1. Subcellular location: Mitochondrion. Tissue specificity: Found in skeletal muscle, liver, heart, brain, kidney, pancreas, lung and placenta. Sequence similarities: Belongs to the heat shock protein 90 family. Sequence caution: The sequence AAA87704.1 differs from that shown. Reason: Frameshift at position 656.
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!