product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Zinc finger BED domain-containing protein 1
catalog :
MBS717143
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717143
products type :
Recombinant Protein
products full name :
Recombinant human Zinc finger BED domain-containing protein 1
products short name :
Zinc finger BED domain-containing protein 1
other names :
Homo sapiens zinc finger, BED-type containing 1 (ZBED1), transcript variant 2, mRNA; Zinc finger BED domain-containing protein 1; zinc finger BED domain-containing protein 1; dREF homolog; Ac-like transposable element; DNA replication-related element binding factor; BED-type zinc finger domain-containing protein 1; zinc finger, BED-type containing 1; Putative Ac-like transposable element; dREF homolog
other gene names :
ZBED1; ZBED1; ALTE; DREF; TRAMP; hDREF; ALTE; DREF; KIAA0785; TRAMP
uniprot entry name :
ZBED1_HUMAN
host :
E Coli
sequence :
MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCI
LQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPEEFCEF
VKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHG
YDSKKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTA
DPRYELPSRKYISTKAIPEKYGAVREVILKELAEATWCG
ISTDMWRSENQNRAY
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
ncbi gi num :
57165426
ncbi acc num :
NP_004720.1
ncbi gb acc num :
NM_004729.3
uniprot acc num :
O96006
ncbi mol weight :
50 KD
ncbi summary :
This gene is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. It was earlier identified as a gene with similarity to Ac transposable elements, however, was found not to have transposase activity. Later studies show that this gene product is localized in the nucleus and functions as a transcription factor. It binds to DNA elements found in the promoter regions of several genes related to cell proliferation, such as histone H1, hence may have a role in regulating genes related to cell proliferation. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene. [provided by RefSeq, Jan 2010]
uniprot summary :
Function: Binds to 5'-TGTCG[CT]GA[CT]A-3' DNA elements found in the promoter regions of a number of genes related to cell proliferation. Binds to the histone H1 promoter and stimulates transcription. Was first identified as gene weakly similar to Ac transposable elements, but does not code for any transposase activity. Ref.5. Subunit structure: Homodimer . Potential. Subcellular location: Nucleus. Note: In granular structures. Ref.5. Tissue specificity: Ubiquitously expressed at low levels. Expression is highest in skeletal muscle, heart, spleen and placenta. Induction: Expression is linked to the cell cycle: low in serum-starved fibroblasts, increasing during the G1/S phase, highest during the S/G2 phase and then decreasing again. Ref.5. Miscellaneous: The gene encoding for this protein is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Sequence similarities: Contains 1 BED-type zinc finger. Sequence caution: The sequence BAA34505.2 differs from that shown. Reason: Erroneous initiation.
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!