product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant New Delhi Beta-lactamase NDM-1
catalog :
MBS717124
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS717124
products type :
Recombinant Protein
products full name :
Recombinant New Delhi Beta-lactamase NDM-1
products short name :
New Delhi Beta-lactamase NDM-1
other names :
MULTISPECIES: subclass B1 metallo-beta-lactamase NDM-1; Beta-lactamase; New Delhi metallo-beta-lactamse 1; Beta-lactamase
products gene name :
NDM-1
other gene names :
blaNDM-1; NDM-1
uniprot entry name :
F8UNN7_ACIBA
host :
E Coli
sequence positions :
164-222, Partial.
sequence length :
222
sequence :
AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTD
IAFGGCLIKDSKAKSLGNLG
IAFGGCLIKDSKAKSLGNLG
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products references :
Molecular characterization of blaNDM-1 in an Acinetobacter baumannii strain isolated in Germany in 2007.Pfeifer Y., Wilharm G., Zander E., Wichelhaus T.A., Gottig S., Hunfeld K.P., Seifert H., Witte W., Higgins P.G.J. Antimicrob. Chemother. 66:1998-2001(2011)
Characterization of a new metallo-beta-lactamase 1 gene (blaNDM-1)
among clinical strains from Vietnam.Cao V., Hoang N.K.Q., Le H.T.D., Le T.L. Tn125-Related Acquisition of blaNDM-Like Genes in Acinetobacter baumannii.Poirel L., Bonnin R.A., Boulanger A., Schrenzel J., Kaase M., Nordmann P.Antimicrob. Agents Chemother. 56:1087-1089(2012)
Dissemination of New Delhi metallo-?-lactamase-1-producing Acinetobacter baumannii in Europe.Bonnin R.A., Poirel L., Naas T., Pirs M., Seme K., Schrenzel J., Nordmann P.Clin. Microbiol. Infect. 18:E362-E365(2012)
Molecular characteristics and epidemiology of a novel sequence type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Molecular characteristics and Epidemiology of Novel Sequence Type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Complete sequence of the blaNDM-1-carrying plasmid pNDM-AB from Acinetobacter baumannii of food animal origin.Zhang W.J., Lu Z., Schwarz S., Zhang R.M., Wang X.M., Si W., Yu S., Chen L., Liu S.J. Antimicrob. Chemother. 68:1681-1682(2013)
blaNDM-1 context 1 from Acinetobacter baumannii CHI-45-1.Jones L.S., Toleman M.A., Weeks J.L., Kumarasamy K.K., Howe R.A., Walsh T.R. blaNDM-1 context 2 from Acinetobacter baumannii CHI-45-1.Jones L.S., Toleman M.A., Weeks J.L., Kumarasamy K.K., Howe R.A., Walsh T.R. Drug resistance of aerobic bacteria from puerperal infections in Bangladesh.Kobayashi N., Kawaguchiya M., Ahmed S. Complete genome sequence of Acinetobacter baumannii IOMTU433.Tada T., Shrestha S., Miyoshi-Akiyama T., Shimada K., Kirikae T. NDM-1-Producing Citrobacter freundii, Escherichia coli and Acinetobacter baumannii Identified from a Single Patient in China.Tian G.-B.
ncbi gi num :
490306043
ncbi acc num :
WP_004201164.1
ncbi gb acc num :
WP_004201164.1
uniprot acc num :
F8UNN7
ncbi mol weight :
10.1kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!