product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Chicken anemia virus Apoptin protein
catalog :
MBS717121
quantity :
0.05 mg
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717121
products type :
Recombinant Protein
products full name :
Recombinant Chicken anemia virus Apoptin protein
products short name :
anemia virus Apoptin
products name syn :
VP3 protein
host :
E Coli
sequence positions :
1-121, Full length.
sequence length :
121
sequence :
MNALQEDTPPGPSTVFRPPTSSRPLETPHCREIRIGIAG
ITITLSLCGCANARAPTLRSATADNSESTGFKNVPDLRT
DQPKPPSKKRSCDPSEYRVSELKESLITTTPSRPRTARR
CIRL
purity :
>90% (SDS-PAGE)
storage stability :
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
tested application :
ELISA (EIA), Western Blot (WB)
products description :
May act as transcriptional regulator. Induces apoptosis in infected cells. Element of infectious replication cycle. VP1 and VP2 are detected 12 hours post infection, while VP3 only after 24 hours. Belongs to the gyrovirus apoptin family.
ncbi mol weight :
42 KD
size1 :
0.05 mg
price1 :
180 USD
size2 :
0.2 mg
price2 :
490
size3 :
0.5 mg
price3 :
715
size4 :
1 mg
price4 :
1170
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!