product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Transcription intermediary factor 1-beta protein
catalog :
MBS717118
quantity :
0.05 mg
price :
195 USD
more info or order :
product information
catalog number :
MBS717118
products type :
Recombinant Protein
products full name :
Recombinant human Transcription intermediary factor 1-beta protein
products short name :
Transcription intermediary factor 1-beta protein
other names :
Homo sapiens tripartite motif containing 28 (TRIM28), mRNA; Transcription intermediary factor 1-beta; transcription intermediary factor 1-beta; KAP-1; KRIP-1; TIF1-beta; RING finger protein 96; KRAB-associated protein 1; nuclear corepressor KAP-1; KRAB-interacting protein 1; E3 SUMO-protein ligase TRIM28; tripartite motif-containing 28; tripartite motif-containing protein 28; transcriptional intermediary factor 1-beta; tripartite motif containing 28; E3 SUMO-protein ligase TRIM28 (EC:6.3.2.-); KRAB-associated protein 1; KAP-1; KRAB-interacting protein 1; KRIP-1; Nuclear corepressor KAP-1; RING finger protein 96; Tripartite motif-containing protein 28
other gene names :
TRIM28; TRIM28; KAP1; TF1B; RNF96; TIF1B; KAP1; RNF96; TIF1B; TIF1-beta; KAP-1; KRIP-1
uniprot entry name :
TIF1B_HUMAN
host :
E Coli
sequence :
PGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALE
LLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAA
ANSSGDGGAAGDGTVVDCPVCKQQCFSKDIVENYFMRDS
GSKAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETC
VEAHQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEP
LVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVRNQRKL
LASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRV
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
ncbi gi num :
14971416
ncbi acc num :
NP_005753.1
ncbi gb acc num :
NM_005762.2
uniprot acc num :
Q13263
ncbi mol weight :
57 KD
ncbi pathways :
C-MYB Transcription Factor Network Pathway 138073!!E2F Transcription Factor Network Pathway 137934!!Gene Expression Pathway 105937!!Generic Transcription Pathway 105938!!P53 Pathway 138067
ncbi summary :
The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Nuclear corepressor for KRAB domain-containing zinc finger proteins (KRAB-ZFPs). Mediates gene silencing by recruiting CHD3, a subunit of the nucleosome remodeling and deacetylation (NuRD) complex, and SETDB1 (which specifically methylates histone H3 at 'Lys-9' (H3K9me)) to the promoter regions of KRAB target genes. Enhances transcriptional repression by coordinating the increase in H3K9me, the decrease in histone H3 'Lys-9 and 'Lys-14' acetylation (H3K9ac and H3K14ac, respectively) and the disposition of HP1 proteins to silence gene expression. Recruitment of SETDB1 induces heterochromatinization. May play a role as a coactivator for CEBPB and NR3C1 in the transcriptional activation of ORM1. Also corepressor for ERBB4. Inhibits E2F1 activity by stimulating E2F1-HDAC1 complex formation and inhibiting E2F1 acetylation. May serve as a partial backup to prevent E2F1-mediated apoptosis in the absence of RB1. Important regulator of CDKN1A/p21(CIP1). Has E3 SUMO-protein ligase activity toward itself via its PHD-type zinc finger. Also specifically sumoylates IRF7, thereby inhibiting its transactivation activity. Ubiquitinates p53/TP53 leading to its proteosomal degradation; the function is enhanced by MAGEC2 and MAGEA2, and possibly MAGEA3 and MAGEA6. Ref.1 Ref.2 Ref.9 Ref.12 Ref.13 Ref.15 Ref.19 Ref.22 Ref.24 Ref.25 Ref.26 Ref.29 Ref.33 Ref.42 Ref.43 Ref.45 Ref.47. Pathway: Protein modification; protein sumoylation. Subunit structure: Oligomer; the RBCC domain homotrimerizes and interacts with one molecule of KRAB to form the KRAB-KAP1 corepressor complex. Binding to a KRAB domain is an absolute requirement for silencing gene expression. Interacts with CEBPB and NR3C1 . By similarity. Interacts with a number of KRAB-ZFP proteins including ZNF10, ZFP53, ZFP68, ZNF382 and ZNF256. Interacts with NCOR1, NR3C1 and CHD3. Interacts with CEBPB (via the RING-type and PHD-type zinc fingers). Component of a ternary complex that includes TRIM28, a HP1 protein (CBX1, CBX3 OR CBX5), a KRAB domain-containing protein, and DNA. Interacts with CBX5 (via the PxVxL motif); the interaction occurs in interphase nuclei and competes for binding POGZ. Interacts with POGZ; the interaction competes for interaction with CBX5. Interacts with SETDB1; the interaction is enhanced by KAP1 sumoylation, stimulates SETB1 histone methyltransferase activity and gene silencing. Interacts (via the PHD-type zinc finger) with UBE2I; the interaction is required for sumoylation and repressor activity. Component of the TRIM28/KAP1-ERBB4-MDM2 complex involved in connecting growth factor and DNA damage responses. Interacts directly with ERBB4; the interaction represses ERBB4-mediated transcription activity. Interacts with MDM2; the interaction contributes to p53/TP53 inactivation. Component of the TRIM28/KAP1-MDM2-p53/TP53; involved in regulating p53/TP53 stabilization and activity. Interacts (via the leucine zipper alpha helical coiled-coil) with E2F1 (central region); the interaction inhibits E2F1 acetylation and transcriptional activity. Interacts with PPP1CA; the interaction dephosphorylates TRIM28 at Ser-824 and forms a complex at the p21 promoter site. Interacts with PPP1CB; the interaction is weak but is increased on dephosphorylation at Ser-824. Interacts with FES/FPS. Interacts with SMARCAD1. Interacts with, and sumoylates IRF7. Interacts with MAGEC2. Part of a complex composed of TRIM28, HDAC1, HDAC2 and EHMT2. Ref.2 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.15 Ref.17 Ref.18 Ref.23 Ref.24 Ref.25 Ref.27 Ref.29 Ref.33 Ref.34 Ref.42 Ref.43 Ref.44 Ref.45 Ref.47 Ref.48. Subcellular location: Nucleus. Note: Associated with centromeric heterochromatin during cell differentiation through CBX1 . By similarity. Ref.2 Ref.8 Ref.19 Ref.42. Tissue specificity: Expressed in all tissues tested including spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. Ref.2. Domain: The HP1 box is both necessary and sufficient for HP1 binding. Ref.27 Ref.29The PHD-type zinc finger enhances CEBPB transcriptional activity. The PHD-type zinc finger, the HP1 box and the bromo domain, function together to assemble the machinery required for repression of KRAB domain-containing proteins. Acts as an intramolecular SUMO E3 ligase for autosumoylation of bromodomain. Ref.27 Ref.29The RING-finger-B Box-coiled-coil/tripartite motif (RBCC/TRIM motif) is required for interaction with the KRAB domain of KRAB-zinc finger proteins. Binds four zinc ions per molecule. The RING finger and the N-terminal of the leucine zipper alpha helical coiled-coil region of RBCC are required for oligomerization. Ref.27 Ref.29Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is required for interaction with chromoshadow domains. This motif requires additional residues -7, -6, +4 and +5 of the central Val which contact the chromoshadow domain. Ref.27 Ref.29. Post-translational modification: Phosphorylated upon DNA damage, probably by ATM or ATR. ATM-induced phosphorylation on Ser-824 represses sumoylation leading to the de-repression of expression of a subset of genes involved in cell cycle control and apoptosis in response to genotoxic stress. Dephosphorylation by the phosphatases, PPP1CA and PP1CB forms, allows sumoylation and expression of TRIM28 target genes. Ref.14 Ref.16 Ref.18 Ref.19 Ref.20 Ref.21 Ref.22 Ref.26 Ref.28 Ref.30 Ref.31 Ref.32 Ref.35 Ref.36 Ref.37 Ref.38 Ref.39 Ref.45Sumoylation/desumoylation events regulate TRIM28-mediated transcriptional repression. Sumoylation is required for interaction with CHD3 and SETDB1 and the corepressor activity. Represses and is repressed by Ser-824 phosphorylation. Enhances the TRIM28 corepressor activity, inhibiting transcriptional activity of a number of genes including GADD45A and CDKN1A/p21. Lys-554, Lys-779 and Lys-804 are the major sites of sumoylation. In response to Dox-induced DNA damage, enhanced phosphorylation on Ser-824 prevents sumoylation and allows de-repression of CDKN1A/p21.Auto-ubiquitinated; enhanced by MAGEA2 and MAGEC2. Sequence similarities: Belongs to the TRIM/RBCC family.Contains 2 B box-type zinc fingers.Contains 1 bromo domain.Contains 1 PHD-type zinc finger.Contains 1 RING-type zinc finger.
size :
0.05 mg
price :
195 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!