protein

Recombinant Human 26S proteasome non-ATPase regulatory subunit 11 protein

MBS717117

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human 26S proteasome non-ATPase regulatory subunit 11 protein

26S proteasome non-ATPase regulatory subunit 11

26S proteasome regulatory subunit RPN626S proteasome regulatory subunit S926S proteasome regulatory subunit p44.5

26S proteasome non-ATPase regulatory subunit 11; 26S proteasome non-ATPase regulatory subunit 11; 26S proteasome non-ATPase regulatory subunit 11; proteasome 26S subunit, non-ATPase 11; 26S proteasome regulatory subunit RPN6; 26S proteasome regulatory subunit S9; 26S proteasome regulatory subunit p44.5

PSMD11

PSMD11; PSMD11; S9; Rpn6; p44.5

PSD11_HUMAN

E Coli

2-422

422

AAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDE
EAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNS
ISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAK
SEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLREL
KKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTT
ANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEA
FEGYDSIDSPKAITSLKYMLL

Greater than 90% as determined by SDS-PAGE.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cell Biology

Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. In the complex, PSMD11 is required for proteasome assembly. Plays a key role in increased proteasome activity in embryonic st cells (ESCs): its high expression in ESCs promotes enhanced assembly of the 26S proteasome, followed by higher proteasome activity.

Molecular cloning and expression of subunit 9 of the 26S proteasome.Hoffman L., Rechsteiner M.FEBS Lett. 404:179-184(1997) cDNA cloning and functional analysis of p44.5 and p55, two regulatory subunits of the 26S proteasome.Saito A., Watanabe T.K., Shimada Y., Fujiwara T., Slaughter C.A., De;Martino G.N., Tanahashi N., Tanaka K.Gene 203:241-250(1997) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.

394953908

NP_001257411.1

NM_001270482.1

O00231

74.7kD

APC/C-mediated Degradation Of Cell Cycle Proteins Pathway (1269838); APC/C:Cdc20 Mediated Degradation Of Securin Pathway (1269849); APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway (1269844); APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway (1269851); APC:Cdc20 Mediated Degradation Of Cell Cycle Proteins Prior To Satisfation Of The Cell Cycle Checkpoint Pathway (1269845); ARMS-mediated Activation Pathway (1269471); AUF1 (hnRNP D0) Binds And Destabilizes MRNA Pathway (1269726); Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway (1269842); Activation Of NF-kappaB In B Cells Pathway (1269186); Adaptive Immune System Pathway (1269171)

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the proteasome subunit S9 family that functions as a non-ATPase subunit of the 19S regulator and is phosphorylated by AMP-activated protein kinase. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

PSMD11: Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. In the complex, PSMD11 is required for proteasome assembly. Plays a key role in increased proteasome activity in embryonic stem cells (ESCs): its high expression in ESCs promotes enhanced assembly of the 26S proteasome, followed by higher proteasome activity. Belongs to the proteasome subunit S9 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Proteasome complex; Protease. Chromosomal Location of Human Ortholog: 17q11.2. Cellular Component: cytosol; membrane; nucleoplasm; nucleus; proteasome complex; proteasome regulatory particle. Molecular Function: protein binding. Biological Process: activation of MAPKK activity; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of peptide antigen via MHC class I; apoptosis; axon guidance; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; G1/S transition of mitotic cell cycle; gene expression; innate immune response; insulin receptor signaling pathway; MAPKKK cascade; mitotic cell cycle; negative regulation of apoptosis; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; nerve growth factor receptor signaling pathway; polyamine metabolic process; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; programmed cell death; proteasome assembly; protein polyubiquitination; Ras protein signal transduction; regulation of amino acid metabolic process; regulation of apoptosis; regulation of mRNA stability; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; small GTPase mediated signal transduction; stem cell differentiation; stimulatory C-type lectin receptor signaling pathway; T cell receptor signaling pathway; tumor necrosis factor-mediated signaling pathway; ubiquitin-dependent protein catabolic process; vascular endothelial growth factor receptor signaling pathway; viral reproduction

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180