protein

Recombinant Human 14-3-3 protein beta/alpha

MBS717113

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human 14-3-3 protein beta/alpha

14-3-3 protein beta/alpha

Protein 1054; Protein kinase C inhibitor protein 1; KCIP-1

14-3-3 protein beta/alpha; 14-3-3 protein beta/alpha; 14-3-3 protein beta/alpha; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta; Protein 1054; Protein kinase C inhibitor protein 1; KCIP-1

YWHAB

YWHAB; YWHAB; HS1; GW128; YWHAA; KCIP-1; HEL-S-1; KCIP-1

1433B_HUMAN

E Coli

1-246

246

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELS
NEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQ
QMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESK
VFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFE
ISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAK
TAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSEN
QGDEGDAGEGEN

Greater than 90% as determined by SDS-PAGE.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Signal Transduction

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2.

Molecular cloning and expression of the transformation sensitive epithelial marker stratifin. A member of a protein family that has been involved in the protein kinase C signalling pathway.Leffers H., Madsen P., Rasmussen H.H., Honore B., Andersen A.H., Walbum E., Vandekerckhove J., Celis J.E.J. Mol. Biol. 231:982-998(1993) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence and comparative analysis of human chromosome 20.Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.Nature 414:865-871(2001)

4507949

NP_003395.1

NM_003404.4

P31946

55.5kD

ARMS-mediated Activation Pathway (1269471); Activation Of BAD And Translocation To Mitochondria Pathway (1270271); Activation Of BH3-only Proteins Pathway (1270270); Adaptive Immune System Pathway (1269171); Alpha6-Beta4 Integrin Signaling Pathway (198807); Apoptosis Pathway (1270262); Axon Guidance Pathway (1270303); Butyrate Response Factor 1 (BRF1) Binds And Destabilizes MRNA Pathway (1269727); Calcium Regulation In The Cardiac Cell Pathway (198906); Cell Cycle Pathway (1269741)

This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]

14-3-3 beta: a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes. Protein type: Adaptor/scaffold. Chromosomal Location of Human Ortholog: 20q13.1. Cellular Component: cytoplasm; cytoplasmic vesicle membrane; cytosol; focal adhesion; melanosome; membrane; mitochondrion; nucleus; perinuclear region of cytoplasm; transcriptional repressor complex. Molecular Function: enzyme binding; histone deacetylase binding; phosphoprotein binding; phosphoserine binding; protein binding; protein C-terminus binding; protein complex binding; protein domain specific binding; transcription corepressor activity. Biological Process: activation of MAPKK activity; apoptosis; axon guidance; cytoplasmic sequestering of protein; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; gene expression; innate immune response; insulin receptor signaling pathway; MAPKKK cascade; negative regulation of protein amino acid dephosphorylation; negative regulation of transcription, DNA-dependent; nerve growth factor receptor signaling pathway; positive regulation of catalytic activity; programmed cell death; protein heterooligomerization; protein targeting; Ras protein signal transduction; regulation of mRNA stability; small GTPase mediated signal transduction; transcription initiation from RNA polymerase II promoter; vascular endothelial growth factor receptor signaling pathway; viral reproduction

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180