Recombinant Human Protein AATF | MyBioSource MBS717108 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Protein AATF

catalog :

MBS717108

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717108

products type :

Recombinant Protein

products full name :

Recombinant Human Protein AATF

products short name :

AATF

products name syn :

Apoptosis-antagonizing transcription factor; Rb-binding protein Che-1

other names :

protein AATF; Protein AATF; protein AATF; apoptosis antagonizing transcription factor; Apoptosis-antagonizing transcription factor; Rb-binding protein Che-1

products gene name :

AATF

other gene names :

AATF; AATF; DED; BFR2; CHE1; CHE-1; CHE1; DED

uniprot entry name :

AATF_HUMAN

host :

E Coli

sequence positions :

6-294

sequence length :

560

sequence :

PLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGE
DGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNE
DHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDL
GAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFT
KGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGD
RNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLE
GRIKLQKALLTTNQLPQPDVF

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Epigenetics and Nuclear Signaling

products description :

May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacent of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dentia), although the molecular basis for this phenomenon has not been described to date.

products references :

Identification of novel transcription factor-like gene from human intestinal cells.Lindfors K., Halttunen T., Huotari P., Nupponen N., Vihinen M., Visakorpi T., Maki M., Kainulainen H.Biochem. Biophys. Res. Commun. 276:660-666(2000) Identification of a novel partner of RNA polymerase II subunit 11, Che-1, which interacts with and affects the growth suppression function of Rb.Fanciulli M., Bruno T., Di Padova M., De Angelis R., Iezzi S., Iacobini C., Floridi A., Passananti C.FASEB J. 14:904-912(2000) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006)

ncbi gi num :

7657013

ncbi acc num :

NP_036270.1

ncbi gb acc num :

NM_012138.3

uniprot acc num :

Q9NY61

ncbi mol weight :

59.1kD

ncbi pathways :

Cell Death Signalling Via NRAGE, NRIF And NADE Pathway (1269447); NRAGE Signals Death Through JNK Pathway (1269448); Regulation Of Retinoblastoma Protein Pathway (137916); Signal Transduction Pathway (1269379); Signalling By NGF Pathway (1269443); P75 NTR Receptor-mediated Signalling Pathway (1269445)

ncbi summary :

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq, Jul 2008]

uniprot summary :

AATF: May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacement of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dementia), although the molecular basis for this phenomenon has not been described to date. Belongs to the AATF family. Protein type: Nucleolus; RNA-binding; Transcription factor. Chromosomal Location of Human Ortholog: 17q12. Cellular Component: centrosome; cytoplasm; focal adhesion; Golgi apparatus; nucleolus; nucleus. Molecular Function: leucine zipper domain binding; protein binding; tau protein binding; transcription factor activity. Biological Process: cell adhesion; embryonic cleavage; negative regulation of amyloid precursor protein biosynthetic process; negative regulation of apoptosis; negative regulation of superoxide release; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; positive regulation of transcription from RNA polymerase II promoter; regulation of mitotic cell cycle; response to DNA damage stimulus; ribosome biogenesis and assembly

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage