product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Cytochrome c1, heme protein, mitochondrial
catalog :
MBS717106
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS717106
products type :
Recombinant Protein
products full name :
Recombinant Human Cytochrome c1, heme protein, mitochondrial
products short name :
Cytochrome c1
products name syn :
Complex III subunit 4; Complex III subunit IV; Cytochrome b-c1 complex subunit 4; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit; Cytochrome c-1
other names :
cytochrome c1, heme protein, mitochondrial; Cytochrome c1, heme protein, mitochondrial; cytochrome c1, heme protein, mitochondrial; cytochrome c1; Complex III subunit 4; Complex III subunit IV; Cytochrome b-c1 complex subunit 4; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit; Cytochrome c-1
products gene name :
CYC1
other gene names :
CYC1; CYC1; UQCR4; MC3DN6; Cytochrome c-1
uniprot entry name :
CY1_HUMAN
host :
E Coli
sequence positions :
85-325
sequence length :
325
sequence :
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCAS
CHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDG
EMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIV
RARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASE
PEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRK
LAYRPPK
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Transport
products description :
This is the he-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
products references :
Nucleotide sequence of a cDNA encoding the precursor to human cytochrome c1.Nishikimi M., Ohta S., Suzuki H., Tanaka T., Kikkawa F., Tanaka M., Kagawa Y., Ozawa T.Nucleic Acids Res. 16:3577-3577(1988) Structural organization of the human mitochondrial cytochrome c1 gene.Suzuki H., Hosokawa Y., Nishikimi M., Ozawa T.J. Biol. Chem. 264:1368-1374(1989) Isolation of a cDNA clone for human cytochrome c1 from a lambda gt11 expression library.Nishikimi M., Suzuki H., Ohta S., Sakurai T., Shimomura Y., Tanaka M., Kagawa Y., Ozawa T.Biochem. Biophys. Res. Commun. 145:34-39(1987) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) A mitochondrial cytochrome b mutation but no mutations of nuclearly encoded subunits in ubiquinol cytochrome c reductase (complex III) deficiency.Valnot I., Kassis J., Chretien D., de Lonlay P., Parfait B., Munnich A., Kachaner J., Rustin P., Roetig A.Hum. Genet. 104:460-466(1999) Mutations in CYC1, encoding cytochrome c1 subunit of respiratory chain complex III, cause insulin-responsive hyperglycemia.Gaignard P., Menezes M., Schiff M., Bayot A., Rak M., Ogier de Baulny H., Su C.H., Gilleron M., Lombes A., Abida H., Tzagoloff A., Riley L., Cooper S.T., Mina K., Sivadorai P., Davis M.R., Allcock R.J., Kresoje N., Laing N.G., Thorburn D.R., Slama A., Christodoulou J., Rustin P.Am. J. Hum. Genet. 93:384-389(2013)
ncbi gi num :
21359867
ncbi acc num :
NP_001907.2
ncbi gb acc num :
NM_001916.4
uniprot acc num :
P08574
ncbi mol weight :
54.7kD
ncbi pathways :
Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Cardiac Muscle Contraction Pathway (93344); Cardiac Muscle Contraction Pathway (93992); Cytochrome Bc1 Complex Pathway (413442); Cytochrome Bc1 Complex Pathway (546500); Cytochrome Bc1 Complex Respiratory Unit Pathway (413411); Cytochrome Bc1 Complex Respiratory Unit Pathway (468344); Huntington's Disease Pathway (83100); Huntington's Disease Pathway (512)
ncbi summary :
This gene encodes a subunit of the cytochrome bc1 complex, which plays an important role in the mitochondrial respiratory chain by transferring electrons from the Rieske iron-sulfur protein to cytochrome c. Mutations in this gene may cause mitochondrial complex III deficiency, nuclear type 6. [provided by RefSeq, Dec 2013]
uniprot summary :
CYC1: This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain. Belongs to the cytochrome c family. Protein type: Energy Metabolism - oxidative phosphorylation; Oxidoreductase; Mitochondrial; Membrane protein, integral. Chromosomal Location of Human Ortholog: 8q24.3. Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion; nucleus. Molecular Function: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity; heme binding; metal ion binding. Biological Process: cellular metabolic process; response to glucagon stimulus. Disease: Mitochondrial Complex Iii Deficiency, Nuclear Type 6
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!