Recombinant Human Cytochrome c1, heme protein, mitochondrial | MyBioSource MBS717106 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Cytochrome c1, heme protein, mitochondrial

catalog :

MBS717106

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717106

products type :

Recombinant Protein

products full name :

Recombinant Human Cytochrome c1, heme protein, mitochondrial

products short name :

Cytochrome c1

products name syn :

Complex III subunit 4; Complex III subunit IV; Cytochrome b-c1 complex subunit 4; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit; Cytochrome c-1

other names :

cytochrome c1, heme protein, mitochondrial; Cytochrome c1, heme protein, mitochondrial; cytochrome c1, heme protein, mitochondrial; cytochrome c1; Complex III subunit 4; Complex III subunit IV; Cytochrome b-c1 complex subunit 4; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit; Cytochrome c-1

products gene name :

CYC1

other gene names :

CYC1; CYC1; UQCR4; MC3DN6; Cytochrome c-1

uniprot entry name :

CY1_HUMAN

host :

E Coli

sequence positions :

85-325

sequence length :

325

sequence :

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCAS
CHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDG
EMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIV
RARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASE
PEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRK
LAYRPPK

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transport

products description :

This is the he-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.

products references :

Nucleotide sequence of a cDNA encoding the precursor to human cytochrome c1.Nishikimi M., Ohta S., Suzuki H., Tanaka T., Kikkawa F., Tanaka M., Kagawa Y., Ozawa T.Nucleic Acids Res. 16:3577-3577(1988) Structural organization of the human mitochondrial cytochrome c1 gene.Suzuki H., Hosokawa Y., Nishikimi M., Ozawa T.J. Biol. Chem. 264:1368-1374(1989) Isolation of a cDNA clone for human cytochrome c1 from a lambda gt11 expression library.Nishikimi M., Suzuki H., Ohta S., Sakurai T., Shimomura Y., Tanaka M., Kagawa Y., Ozawa T.Biochem. Biophys. Res. Commun. 145:34-39(1987) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) A mitochondrial cytochrome b mutation but no mutations of nuclearly encoded subunits in ubiquinol cytochrome c reductase (complex III) deficiency.Valnot I., Kassis J., Chretien D., de Lonlay P., Parfait B., Munnich A., Kachaner J., Rustin P., Roetig A.Hum. Genet. 104:460-466(1999) Mutations in CYC1, encoding cytochrome c1 subunit of respiratory chain complex III, cause insulin-responsive hyperglycemia.Gaignard P., Menezes M., Schiff M., Bayot A., Rak M., Ogier de Baulny H., Su C.H., Gilleron M., Lombes A., Abida H., Tzagoloff A., Riley L., Cooper S.T., Mina K., Sivadorai P., Davis M.R., Allcock R.J., Kresoje N., Laing N.G., Thorburn D.R., Slama A., Christodoulou J., Rustin P.Am. J. Hum. Genet. 93:384-389(2013)

ncbi gi num :

21359867

ncbi acc num :

NP_001907.2

ncbi gb acc num :

NM_001916.4

uniprot acc num :

P08574

ncbi mol weight :

54.7kD

ncbi pathways :

Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Cardiac Muscle Contraction Pathway (93344); Cardiac Muscle Contraction Pathway (93992); Cytochrome Bc1 Complex Pathway (413442); Cytochrome Bc1 Complex Pathway (546500); Cytochrome Bc1 Complex Respiratory Unit Pathway (413411); Cytochrome Bc1 Complex Respiratory Unit Pathway (468344); Huntington's Disease Pathway (83100); Huntington's Disease Pathway (512)

ncbi summary :

This gene encodes a subunit of the cytochrome bc1 complex, which plays an important role in the mitochondrial respiratory chain by transferring electrons from the Rieske iron-sulfur protein to cytochrome c. Mutations in this gene may cause mitochondrial complex III deficiency, nuclear type 6. [provided by RefSeq, Dec 2013]

uniprot summary :

CYC1: This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain. Belongs to the cytochrome c family. Protein type: Energy Metabolism - oxidative phosphorylation; Oxidoreductase; Mitochondrial; Membrane protein, integral. Chromosomal Location of Human Ortholog: 8q24.3. Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion; nucleus. Molecular Function: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity; heme binding; metal ion binding. Biological Process: cellular metabolic process; response to glucagon stimulus. Disease: Mitochondrial Complex Iii Deficiency, Nuclear Type 6

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage