product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human U1 small nuclear ribonucleoprotein A
catalog :
MBS717096
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717096
products type :
Recombinant Protein
products full name :
Recombinant human U1 small nuclear ribonucleoprotein A
products short name :
U1 small nuclear ribonucleoprotein A
products name syn :
Recombinant human U1 small nuclear ribonucleoprotein A protein
other names :
Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA; U1 small nuclear ribonucleoprotein A; U1 small nuclear ribonucleoprotein A; U1 snRNP A; U1 snRNP-specific protein A; U1 small nuclear RNP-specific A; small nuclear ribonucleoprotein polypeptide A
other gene names :
SNRPA; SNRPA; U1A; Mud1; U1-A; U1 snRNP A; U1-A; U1A
uniprot entry name :
SNRPA_HUMAN
host :
E Coli
sequence :
PNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVS
RSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQ
YAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKA
VQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPY
MPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLS
ENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVP
GRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKIS
purity :
0.95
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: GST tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.
products references :
[1] "Structure, chromosomal localization and evolutionary conservation of the gene encoding human U1 snRNP-specific A protein.
ncbi gi num :
295317321
ncbi acc num :
NP_004587.1
ncbi gb acc num :
NM_004596.4
uniprot acc num :
P09012
ncbi mol weight :
57 KD
ncbi pathways :
Gene Expression Pathway 105937!!Processing Of Capped Intron-Containing Pre-mRNA Pathway 160950!!Spliceosome Pathway 125136!!Spliceosome Pathway 124832!!Spliceosome, U1-snRNP Pathway 413435!!MRNA Splicing Pathway 105951!!MRNA Splicing - Major Pathway 105952!!MRNA Processing Pathway 198843
ncbi summary :
The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010]
uniprot summary :
Function: Binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process. Binds preferentially to the 5'-UGCAC-3' motif in vitro. Ref.5. Subunit structure: Belongs to the spliceosome where it is associated with snRNP U1. Interacts with SFPQ. Also component of a snRNP-free complex with SFPQ. Ref.5. Subcellular location: Nucleus. Sequence similarities: Belongs to the RRM U1 A/B'' family.Contains 2 RRM (RNA recognition motif) domains.
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!