product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Actin-related protein 2/3 complex subunit 2
catalog :
MBS717089
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717089
products type :
Recombinant Protein
products full name :
Recombinant Human Actin-related protein 2/3 complex subunit 2
products short name :
Actin-related protein 2/3 complex subunit 2
products name syn :
Arp2/3 complex 34 kDa subunit; p34-AR; C
other names :
actin-related protein 2/3 complex subunit 2; Actin-related protein 2/3 complex subunit 2; actin-related protein 2/3 complex subunit 2; actin related protein 2/3 complex subunit 2; Arp2/3 complex 34 kDa subunit; p34-ARC
products gene name :
ARPC2
products gene name syn :
ARC34; PRO2446
other gene names :
ARPC2; ARPC2; ARC34; PRO2446; p34-Arc; PNAS-139; ARC34; p34-ARC
uniprot entry name :
ARPC2_HUMAN
host :
E Coli
sequence positions :
1-250
sequence length :
300
sequence :
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFD
GVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKR
VYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLK
RNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVES
KKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTA
PQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNA
SARDNTINLIHTFRDY
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Signal Transduction
products description :
Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Ses to contact the mother actin filament.
products references :
The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly.Welch M.D., Depace A.H., Verma S., Iwamatsu A., Mitchison T.J.J. Cell Biol. 138:375-384(1997)
ncbi gi num :
5031599
ncbi acc num :
NP_005722.1
ncbi gb acc num :
NM_005731.3
uniprot acc num :
O15144
ncbi mol weight :
55.8kD
ncbi pathways :
Axon Guidance Pathway (1270303); B Cell Receptor Signaling Pathway (198909); Bacterial Invasion Of Epithelial Cells Pathway (149807); Bacterial Invasion Of Epithelial Cells Pathway (148661); CDC42 Signaling Events Pathway (137994); Developmental Biology Pathway (1270302); EPH-Ephrin Signaling Pathway (1270330); EPHB-mediated Forward Signaling Pathway (1270332); Endocytosis Pathway (102279); Endocytosis Pathway (102181)
ncbi summary :
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008]
uniprot summary :
ARPC2: Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament. Belongs to the ARPC2 family. Protein type: Motility/polarity/chemotaxis; Cytoskeletal; Actin-binding. Chromosomal Location of Human Ortholog: 2q36.1. Cellular Component: actin cytoskeleton; Arp2/3 protein complex; cytoplasm; cytosol; endosome; focal adhesion; Golgi apparatus; leading edge; neuron projection; synapse. Molecular Function: actin filament binding; protein binding; structural constituent of cytoskeleton. Biological Process: axon guidance; cell motility; ephrin receptor signaling pathway; innate immune response; small GTPase mediated signal transduction
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!