catalog number :
MBS717087
products type :
Recombinant Protein
products full name :
Recombinant Rat Hepatocyte growth factor
products short name :
Hepatocyte growth factor
products name syn :
Hepatopoietin-A; Scatter factor; SF
other names :
hepatocyte growth factor preproprotein; Hepatocyte growth factor; hepatocyte growth factor; hepatocyte growth factor; Hepatopoietin-A; Scatter factor; SF
other gene names :
Hgf; Hgf; HPTA; SF
uniprot entry name :
HGF_RAT
sequence positions :
477-728
sequence :
TIVNLDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYR
NKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIH
DVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAIL
DNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLL
RVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGP
CEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFV
RVAYYAKWIHKVILTYKL
purity :
Greater than 90% as determined by SDS-PAGE.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Potent mitogen for mature parenchymal hepatocyte cells, ses to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
products references :
Deduced primary structure of rat hepatocyte growth factor and expression of the mRNA in rat tissues.Toshiro K., Hagiya M., Nishizawa T., Seki T., Shimonishi M., Shimizu S., Nakamura T.Proc. Natl. Acad. Sci. U.S.A. 87:3200-3204(1990)
Primary structure of rat hepatocyte growth factor and induction of its mRNA during liver regeneration following hepatic injury.Okajima A., Miyazawa K., Kitamura N.Eur. J. Biochem. 193:375-381(1990)
ncbi acc num :
NP_058713.1
ncbi gb acc num :
NM_017017.2
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway (83443); Cytokine-cytokine Receptor Interaction Pathway (460); Focal Adhesion Pathway (83459); Focal Adhesion Pathway (478); Hemostasis Pathway (1333034); Malaria Pathway (152662); Malaria Pathway (152657); Melanoma Pathway (83502); Melanoma Pathway (526); PI3K-Akt Signaling Pathway (692247)
ncbi summary :
plays a role in positive regulation of cell proliferation; may promote entry into the cell cycle [RGD, Feb 2006]