protein

Recombinant human 60S acidic ribosomal protein P1

MBS717082

0.05 mg

195 USD

Recombinant Protein

Recombinant human 60S acidic ribosomal protein P1

60S acidic ribosomal protein P1

Recombinant human 60S acidic ribosomal protein P1 protein

Homo sapiens ribosomal protein, large, P1 (RPLP1), transcript variant 1, mRNA; 60S acidic ribosomal protein P1; 60S acidic ribosomal protein P1; acidic ribosomal phosphoprotein P1; ribosomal protein, large, P1

RPLP1; RPLP1; P1; LP1; RPP1; RRP1

RLA1_HUMAN

E Coli

ASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVE
PFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGG
PAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD

0.95

Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

Tag Information: GST-tagged

Storage Buffer: PBS pH 7.4, 50% glycerol

Plays an important role in the elongation step of protein synthesis.

[1] "Human acidic ribosomal phosphoproteins P0, P1, and P2: analysis of cDNA clones, in vitro synthesis, and assembly.

16905511

NP_000994.1

NM_001003.2

P05386

39 KD

Cap-dependent Translation Initiation Pathway 105967!!Cytoplasmic Ribosomal Proteins Pathway 198853!!Disease Pathway 530764!!Eukaryotic Translation Elongation Pathway 105976!!Eukaryotic Translation Initiation Pathway 105966!!Eukaryotic Translation Termination Pathway 105978!!Formation Of A Pool Of Free 40S Subunits Pathway 105968!!GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway 105973!!Gene Expression Pathway 105937!!Influenza Infection Pathway 106067

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P2. The P1 protein can interact with P0 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Two alternatively spliced transcript variants that encode different proteins have been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Function: Plays an important role in the elongation step of protein synthesis. Subunit structure: P1 and P2 exist as dimers at the large ribosomal subunit. Sequence similarities: Belongs to the ribosomal protein L12P family.

0.05 mg

195 USD